SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379747038|ref|YP_005337859.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379747038|ref|YP_005337859.1|
Domain Number 1 Region: 455-475,514-757
Classification Level Classification E-value
Superfamily HAD-like 9.35e-64
Family Meta-cation ATPase, catalytic domain P 0.00012
Further Details:      
 
Domain Number 2 Region: 262-357
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 7.85e-28
Family Calcium ATPase, transduction domain A 0.0031
Further Details:      
 
Domain Number 3 Region: 227-261,358-449
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000131
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 
Weak hits

Sequence:  gi|379747038|ref|YP_005337859.1|
Domain Number - Region: 6-55
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000997
Family HMA, heavy metal-associated domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379747038|ref|YP_005337859.1|
Sequence length 766
Comment metal cation transporter p-type ATPase, CtpV [Mycobacterium intracellulare ATCC 13950]
Sequence
MDEGRAVAIEETVGNLSGVRTVRVYPRTASVVIRYWPERCDTGAVLSAITEVERSPAASE
PAPVSRSADIGNGGIVGKVVGGIGRMLLGLHSDESEAPPEIERLREALKGIGYHLAPVTE
GQPSPREEAQRGIRAWLRRVWLAWPLGLLASGLTMFFAASPWAGWLAFAATLPVQFIAGW
PFLLGAAQRAREKTANMDTLITLGTLTAFIYSTYQLLVGGPLFFDTSALIIAFVVLGRYF
EAKAHGKTREAISKLLEMGAKEARLLVDGQELLVLIDQVQVGDLLRVRPGEKIPVDGEVV
DGRAGVDESMLTGESVPVEKTVGDHVAGATVNTDGLLTIRATTVGTDTALAQIVRLVEQA
QGGKAPVQRLADRVSAVFVPAVLGVAVATFAGWRLFAANPVAGMTAAVAVLIIACPCALG
LATPTAIMVGTGRGADMGILVKGGEVLEASKKIDTVVFDKTGTLTQAQMRLTDVIADKRR
QPNLVLRIAAAVESGSEHPIGAAIVAGAHERGVEIPAATAFTNLAGHGVRAEVEGRPVVV
GRRKLLDVHDVKLPEHLAAAATEFEEQGRTAVFVGRDGEVVGVLAVADTVKDDAADVVHQ
LHAMGLHVALITGDNTRTAAAIAKQVGIEQVLAEVLPHDKVTEVRRLQDEGRVVAMVGDG
VNDAPALVQADLGIAIGTGTDVAIEASDITLMSGRLDGVVHSIELSRLTLRTIYQNLGWA
FGYNTAAIPLAALGVLNPIVAGAAMGFSSVSVVTNSLRLRRFGRDA
Download sequence
Identical sequences H8IWL2 X8A5H9
gi|379747038|ref|YP_005337859.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]