SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379748788|ref|YP_005339609.1| from Mycobacterium intracellulare ATCC 13950

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379748788|ref|YP_005339609.1|
Domain Number 1 Region: 65-370
Classification Level Classification E-value
Superfamily SIS domain 6.39e-55
Family double-SIS domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|379748788|ref|YP_005339609.1|
Sequence length 370
Comment hypothetical protein OCU_40690 [Mycobacterium intracellulare ATCC 13950]
Sequence
MNATQAIDLEDTDGLLTADRDGLLRAASSAGAQVRAIATAVEEGALDPLSAEDRPRSVIW
VSGRGTAETAGAILAATLNSVASQPFTLAGEAPPWVGPLDVLIVAGDDPGDPALVAAAAT
GVRRGARVVVAAPYEGPLRDATAGHAAVLAPRLGVPDEFGLCRYLAAGLAVVHAVDPRPS
VDLALLADELDAEALRNSAARELFTNPAKLLAARIADRQIALAGDGAATLALARHGSSVL
LRIANQVTPATGLADAVVALRAAASSGFGGAIADPDAALFHDEEIDGPLPPRLRVLAIIL
AAEQTVVAARTAGLDDVYLLAAEDVPDGPGGSAGSGVSPALGGPGRVEQQLAVLAVRLEM
AAVYMRLVRG
Download sequence
Identical sequences H8INY5
WP_014380964.1.3602 gi|379748788|ref|YP_005339609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]