SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|545632827|ref|YP_008583398.1| from Chlamydia pecorum P787

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|545632827|ref|YP_008583398.1|
Domain Number 1 Region: 157-296
Classification Level Classification E-value
Superfamily CBS-domain pair 4.55e-28
Family CBS-domain pair 0.0037
Further Details:      
 
Domain Number 2 Region: 302-377
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000117
Family CorC/HlyC domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|545632827|ref|YP_008583398.1|
Sequence length 402
Comment hypothetical protein CPE3_0239 [Chlamydia pecorum P787]
Sequence
MFYSLSFLLLLFSLTSTGLAQQKPYFGSTIFYVPLLSSYKKKRPPVFFPIVLASSATVLL
VLYGVLGLGIFSELPRYLKHAWLFWPIYVSTCLFFYIFLPTWLFPKLSKSFFNYLRPITT
LLQWLSMPFYKLCKKHFPESTKVSKFHIQLSEAIAEFDHLIVREIMVPKADIFALPEDMS
IQDALLAVVEEGYSRIPLYKKNLDNITGVLLSKDLFHLSTTLGDILQPISNLANPPFYTP
EIKKVSSLLQEFRQKHRHLAIVVNEYGFTEGIATMEDILEEVFGDISDEYDLQEDLPYKK
LGNSWIVDGKMTISDAEEYFRIKIDHEKSYDTLGGHIVHKIGAVPQKGMKLHHDNFDIEI
ITCSERSVGKLKLTPRKRKLHLPGYSGIKEKNLGKKPQDSSE
Download sequence
Identical sequences WP_021757708.1.6974 gi|545632827|ref|YP_008583398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]