SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|545632997|ref|YP_008583568.1| from Chlamydia pecorum P787

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|545632997|ref|YP_008583568.1|
Domain Number 1 Region: 4-90
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-19
Family 2Fe-2S ferredoxin-related 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|545632997|ref|YP_008583568.1|
Sequence length 91
Comment ferredoxin IV [Chlamydia pecorum P787]
Sequence
MAKLIITSEDEQHEFDLENGEQIAESCESAGIPFACTEGVCGTCVVEVLEGKENLSEFTE
AERDFLGDSEDENERLACQCHIKGGCVKLTF
Download sequence
Identical sequences V8TQ85
gi|545632997|ref|YP_008583568.1| gi|330444434|ref|YP_004377420.1| WP_013712795.1.11112 WP_013712795.1.20510 WP_013712795.1.43372 WP_013712795.1.44953 WP_013712795.1.6974 WP_013712795.1.71641 WP_013712795.1.83091 WP_013712795.1.9625 gi|545632071|ref|YP_008582643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]