SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|545633488|ref|YP_008584059.1| from Chlamydia pecorum P787

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|545633488|ref|YP_008584059.1|
Domain Number 1 Region: 117-239
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.62e-23
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.00061
Further Details:      
 
Domain Number 2 Region: 8-115
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.75e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|545633488|ref|YP_008584059.1|
Sequence length 259
Comment succinate dehydrogenase subunit [Chlamydia pecorum P787]
Sequence
MEPKNTFILKIYRGMPGNQYWESFELPLHPGENVISALMEIEKRPINTQGEVVDPVVWEQ
GCLEEVCGSCAMLVNGVPRQACTALIKEYIDTTQSREITLAPLTKFPLVRDLIVDRSVMF
ENLQEIQGWVAADVDGETFGPKVTPEQQELLYTLSMCMTCGCCAEACPQVNAHNDFIGPA
AISQVRYFNSYPGDKRSEERLRRLMGKDGIRGCGQAYNCVRVCPKKLPLTESISIMGRET
SRFSLRKVFSSLFGKKKKT
Download sequence
Identical sequences V8TSC7
WP_013712339.1.10045 WP_013712339.1.11112 WP_013712339.1.20510 WP_013712339.1.34592 WP_013712339.1.43372 WP_013712339.1.44953 WP_013712339.1.6974 WP_013712339.1.71641 WP_013712339.1.76503 WP_013712339.1.9625 gi|330443978|ref|YP_004376964.1| gi|545632562|ref|YP_008583134.1| gi|545633488|ref|YP_008584059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]