SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406025553|ref|YP_006705854.1| from Candidatus Cardinium hertigii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406025553|ref|YP_006705854.1|
Domain Number 1 Region: 60-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 3.27e-21
Family Ribosomal protein L9 C-domain 0.00074
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.0000000000000593
Family Ribosomal protein L9 N-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|406025553|ref|YP_006705854.1|
Sequence length 147
Comment 50S ribosomal protein L9 [Cardinium endosymbiont cEper1 of Encarsia pergandiella]
Sequence
MEVILKTAYKTLGNKGDVVSVRAGYGRNYLIPEGIAVVANATNKKIAFENAKQAAHKGLK
LKADAEALLPLLTSVKVVIAAKVGEGGKIFGSITPLQIAKALKAKNIGVDHTKINIEHPI
KQIGNYQAVLILHETVSYTLTFNVVPA
Download sequence
Identical sequences K0P2G7
gi|406025553|ref|YP_006705854.1| WP_014934801.1.10425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]