SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|406024949|ref|YP_006705250.1| from Candidatus Cardinium hertigii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|406024949|ref|YP_006705250.1|
Domain Number 1 Region: 5-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.19e-53
Family PP-loop ATPase 0.0000477
Further Details:      
 
Domain Number 2 Region: 327-436
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.31e-18
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|406024949|ref|YP_006705250.1|
Sequence length 442
Comment tRNA(Ile)-lysidine synthase [Cardinium endosymbiont cEper1 of Encarsia pergandiella]
Sequence
MFTSFLQFLADKKLIVDSHQTTLLAVSGGVDSVVLCHLFKKACLPFAIAHCNFNLRGAEA
DGETAFVQALAASYEVPFYTTQFDTKTFAHNNKVSIQMAARSLRYEFFDKLLEQYGWDKI
ATAHHWDDVMETILLNFIKGTGIKGFYGIQPMHHQVIRPLLFARKKEIIHYAAEQKLHWE
EDSSNQCNHYQRNFIRNKVIPLLHQVNPNLASTMQTTAIQLKDIGNLFDNHMDQIKKKVS
SFKEGIHYLSIHPIIDQPWATTVTFELLRPYGFSFKQIKQLLKTTRTSGKMIHSTEHTLY
IDRKNWLVSKKKREPFPEQVIADTTRSIPYRNHLLYFHCYKNANYILKKTTMIAALDYDK
LQFPLIIRPWQLGDFFYPLGMKGRKKISDLLIDLKIPIAIKERVCVITSNDQIVWVIGHR
IDERFKVNETTEMVYEITWTKP
Download sequence
Identical sequences K0P8M2
WP_014934204.1.10425 gi|406024949|ref|YP_006705250.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]