SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000569 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000569
Domain Number 1 Region: 20-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.99e-19
Family THAP domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000000569
Domain Number - Region: 231-268
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0131
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000569   Gene: ENSXMAG00000000575   Transcript: ENSXMAT00000000571
Sequence length 472
Comment pep:novel scaffold:Xipmac4.4.2:JH557108.1:46191:49209:-1 gene:ENSXMAG00000000575 transcript:ENSXMAT00000000571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARKDKVVFQRQMKQYHETCCVPQCTASSKYNGLLSFHGFPSDPDLRRQWLANIRRDKL
KLTQHTKVCSLHFTPDQLLQPKAAGGRRVVSRGAVPVLFSWSHRSVQPPGAGLRRPDPPV
GFTPLDHDYCSVPEPADLDRAENENQKLKEDMNALKEQVGELEIPPSFGLQRFAGSDDDI
RFYTRFASYRLFLMFWRLIEPSVHKMIRSSGAAEGSSEAETAVRSTHTGDSLQPIDELLL
FQMYLAAGLKEGDLANRFQIHPSTASRIICSWADYLYSLLGSLCIWADADAVRAQLPEDF
TDFPDTQVIVGSSELRCQTPASALLQTEMSSKSKSHFVMRGLTGTAPHGAVTFVSSLYEG
SVSDTELFMRSGLADRLTEDMAVMVDEGFLVSDCVKCKVYCPPFLSTKPQMASPNVLQTQ
KVARLRVHIERVTRRVKENKLFDSVIPLSMAGNINKLFTVACLLVNYQNKLL
Download sequence
Identical sequences M3ZEC7
ENSXMAP00000000569 ENSXMAP00000000569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]