SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000001815 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000001815
Domain Number 1 Region: 234-481
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.45e-59
Family Decarboxylase 0.000000316
Further Details:      
 
Domain Number 2 Region: 8-201
Classification Level Classification E-value
Superfamily PRTase-like 1.09e-41
Family Phosphoribosyltransferases (PRTases) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000001815   Gene: ENSXMAG00000001814   Transcript: ENSXMAT00000001819
Sequence length 487
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556721.1:517651:525098:-1 gene:ENSXMAG00000001814 transcript:ENSXMAT00000001819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADVSIDSLILKLHDVNAVKFGEYKLKSGLLTPIYIDLRVLVSHPALMNQVSSVIYQRAQ
EENLQFNSVCGVPYTALPLATIICSKHELPMLIRRKEAKDYGTKKMVEGSWCEGDTCLII
EDTVTSGSSILETAEVLHREGLKVTDAIVLMDREQGGMEMLASLGIRLLPIISMFKLLDV
LLAAERIDAPTAQSVRKFILDNNTFRHKKTNGSDAPAPKKPCVEPKRILSYADRAELPKI
HPLASKLLKIMEEKKSNLCVSADVTSNKELLQLAESLGPKICMLKTHCDILKDFTEEFSQ
KLQAVAEQHNFLIFEDRKFADIGNTVKHQYEGGVFRISSWSHIVNAHAVPGPGVVKGLSA
VGKPLGRGCLLIAQMSSQGSLATGEYTQAVVKMAEENSDFVIGFICGSKITEKPEFLHMT
PGVQIKAGGDLMGQQYTTPEDVIYNKGSDVIIVGRGILEASDWLEAAESYRKSGWDAYKR
RSGQSDQ
Download sequence
Identical sequences M3ZHX3
ENSXMAP00000001815 XP_005801302.1.87360 ENSXMAP00000001815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]