SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004258 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004258
Domain Number 1 Region: 29-241
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 8.07e-67
Family D-ribulose-5-phosphate 3-epimerase 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004258   Gene: ENSXMAG00000004245   Transcript: ENSXMAT00000004263
Sequence length 252
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556696.1:631275:637248:1 gene:ENSXMAG00000004245 transcript:ENSXMAT00000004263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRLARLAASVPRLHAHPTNSRHSMAYSAKIGPSILSSDLSCLGSECVRMMECGADYLHL
DVMDGHFVPNITFGHPMVECLRKTVGQDPFFDMHMMVSRPEQWVKPMAAAGASQYTFHVE
ATTNPGNLIKEIRESGMKVGLAIKPGTTVEELAPWANQVDMALVMTVEPGFGGQKFMEDM
MPKVSWLRSQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAVIGSDDPRSVIALLRTA
VAEAIQKRSLDR
Download sequence
Identical sequences M3ZPW5
ENSXMAP00000004258 ENSXMAP00000004258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]