SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006739 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006739
Domain Number 1 Region: 297-425
Classification Level Classification E-value
Superfamily Plus3-like 3.4e-45
Family Plus3 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006739   Gene: ENSXMAG00000006716   Transcript: ENSXMAT00000006747
Sequence length 655
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557580.1:46232:56879:1 gene:ENSXMAG00000006716 transcript:ENSXMAT00000006747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQELLSLAKRKRVDSGEHEEPVNKPAASTDSETSDSDDEWTVGGTKGKKKVKPGKGSE
KKSATKKKVNKATASGSSDGDSSADSSAPEEGEVSDTESNSSSSSSDSDSSEDEVFKDGY
DDDLMGDAEDRARLEQMTEKEREQELFNRIEKREVLRRRFEIKKKLKTAKKKEKEEKKKK
QEEEQEKRKQSQVQDTLVVSMSHNKERRSKRDEKLDKKSQAMEELKAEREKKKNKTAELL
AKREPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSRSSSFDEDEKEETPPKSQPVSLPEEL
NRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNSSSKPVYRVAEIVDVVETTKVYQLGS
TRTNKGLQLRHGADTRVFRLEFVSNQEFTESEFMKWKEAMIVAGMQVPTLDEITKKEQSI
KEAMNYKFNDKDIEDIVKEKDRFRKAPPNYAMKKTQLLKDKAMAEENGDGEKVKTIQDEL
NELEERAEALDRQRTKNISAISYINQRNRSWNIVESEKALVAEGQNSKNQQMDPFTRRQC
KPTMVSNARDPSVHAAILAHLNQKYGSGSGGVDPASTEKNKVGPANPKDKDVPKPTTDLS
EDLFKVHDFDVKIDLQVPNAEAKSLSVSSNALPVKDGAPRRSLNLEDYKKRRGLI
Download sequence
Identical sequences M3ZWZ5
ENSXMAP00000006739 ENSXMAP00000006739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]