SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017197 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000017197
Domain Number - Region: 81-116
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0068
Family KorB DNA-binding domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017197   Gene: ENSXMAG00000017167   Transcript: ENSXMAT00000017221
Sequence length 318
Comment pep:novel scaffold:Xipmac4.4.2:JH557019.1:189804:191610:1 gene:ENSXMAG00000017167 transcript:ENSXMAT00000017221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAVVDLMLENNILRKKIQKTQEQIGSLMLKQCFGIRRFASSDKDIRFFTSILRFLTRLFL
YMFLLTTHSQKKIQFIVTCFPIDEFFLFLNYLARGSKQQDLADQYGVHQSTIIRIITTWS
NFLFMVLGSIRIWIPQDQIHKNLPAVFEDCPDTTVIIDSIELRCQCPSSPLLQSEVSSFY
KSRCTLKGLIGIAPHGPVTFISRLHTGSISDKQITCESGLLALLKPGMAVMVDRGFPIDD
IVPCKVYRPAFLSAGSQMSAGEVRKTKAIARLRVHVECLVRRVKERKLFDSEIPLGVFGI
VNQLYTVACLLTNYENAL
Download sequence
Identical sequences M4ARV2
ENSXMAP00000017197 ENSXMAP00000017197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]