SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018711 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018711
Domain Number 1 Region: 19-101
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.42e-20
Family THAP domain 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000018711
Domain Number - Region: 236-273
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.00366
Family KorB DNA-binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018711   Gene: ENSXMAG00000018672   Transcript: ENSXMAT00000018739
Sequence length 485
Comment pep:novel scaffold:Xipmac4.4.2:JH556682.1:2713554:2716373:1 gene:ENSXMAG00000018672 transcript:ENSXMAT00000018739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRMQKIKYLRATGTTTEFCCVPLCPVSSRCNKFLSFFSFPADEELRKQWIVAIRRADLA
IKAHTRVCSRHFKPEDIKEPETEMGRRRLKKGAVPALFEWNNFSLPLPPLGVCEKRKRSP
PEDGEEEANPPANVCTKEHDYASAPDPAVVDLVLEENYALWEEICQLREQAESLTLRQRF
GIHRFASSDRDIRFFTRFASYDLLMRFWSMIEPSLPSMVSIRQGQRGTAIDSSTQTLQPI
DEFFLFLNYLALGSKQWDLADRYGVHLSTVSWIITAWTNFLFTMLGSIRIWIPEDQIHSS
LPADFKDYPDTTVILDCIELRCQCPSSPILFCKMFSSYKSHCTLKGLIGIAPHGAVTFIS
GLYAGSISDKQITRESGLLSLLKPGMAVMVYRGLIIDDIVPCKVYRPAFFFGRSQMSAGE
VRETPATARLGVHVETLIHRVKEHKLFDSEIPLCVLGIINQLYTVACLLTNYENGSLTKG
SGKDA
Download sequence
Identical sequences M4AW66
ENSXMAP00000018711 ENSXMAP00000018711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]