SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000000794 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000000794
Domain Number 1 Region: 291-433
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-42
Family Third domain of FERM 0.00000957
Further Details:      
 
Domain Number 2 Region: 187-292
Classification Level Classification E-value
Superfamily Second domain of FERM 9.03e-34
Family Second domain of FERM 0.00000386
Further Details:      
 
Domain Number 3 Region: 106-186
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.61e-26
Family First domain of FERM 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000000794   Gene: ENSXMAG00000000786   Transcript: ENSXMAT00000000797
Sequence length 1055
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556730.1:1373780:1427718:1 gene:ENSXMAG00000000786 transcript:ENSXMAT00000000797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGADSEAKQPQAKKEAEKGKSKAAADPASPQNQPEQLPAAVGHSTPARKEQETDIA
KHTSIVLGVHLTLEKEQQEEDQESHRSSTSRLSRSPLRGVKKVKMMQCKITLLDGSDYSV
NVEKRAKGQVLLDKVCEYLNLLEKDYFGITYRDIESQKNWLDPSKELKKQIRNGPWNFSF
NVKFYPPDPSQLCEDITRYYLCLQLRDDVVSGRLPCSFATHTLLGSYTVQSELGDYDLEE
LGSDYISEIRFAPNQTKELEEKVMELHKTYKGMTPAVAEIHFLENAKKLSMYGVDLHHAK
DSEGVEIMLGVCASGLLIYRDRLRINRFAWPKILKISYKRNNFYIKIRPGEFEQFESTIG
FKLPNHRAAKRLWKVCVEHHTFFRLVSPEAPPKKFLSLGSKFRYSGRTQAQTRSASAQIA
RPAPLFERSSSKRYNMSRSLDGAPITENHETPVKGNATDGAPKVIAKEDIITTVTTERKA
EEENAEREDAQEVAAETDATTPLRHDTKVEICPPALTEAYTQSSCFFLFPVLFLYYFVDG
LIRFSFLVLPLTLTFYSCVLMRVPLTASFPPSLLSIHTYVIQPPSPAYASDPLRSELSLP
SSPISSTKLLTTSFSVPYALTLSFPLALCLCYLEPKAASLTASIAQGYHDHDSSEEEEQS
QTDSERTDFACDGEMTATESEADEDSEMRTQDSEPPPEVVKHQTNISELKRSFLETGSNG
GGGAPGLTEWEKRLSSSPLRSPRADEDPMIEPLELQDVSCSRDDGILFKNYPVISPIEKH
RSPFTSGVSLQAAVGYLVKYVADSVVTDGATSSGPHGISLSTTMDDDVFVDGTLREEAGG
KTQDSQEEEEEASDKSATKLSPGAVRQEVSQAISDKKGTLIIFKQAENKEDEETSKKEGL
VDRAESETDGNKEQKRQASLKAEIKHGDVSQAPDGVEVAAKDVPVVHTETKTITYESAEV
DTNGDADPGVLLSAQTITSETTSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDEA
LAQAIKEAKEQHPDMSVTKVVVHKETEITPEEGED
Download sequence
Identical sequences M3ZF02
ENSXMAP00000000794 ENSXMAP00000000794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]