SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002220 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002220
Domain Number 1 Region: 253-392
Classification Level Classification E-value
Superfamily PH domain-like 4e-31
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 2 Region: 146-252
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-22
Family Second domain of FERM 0.00099
Further Details:      
 
Domain Number 3 Region: 57-142
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.44e-19
Family First domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002220   Gene: ENSXMAG00000002210   Transcript: ENSXMAT00000002225
Sequence length 1021
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556885.1:749188:786867:1 gene:ENSXMAG00000002210 transcript:ENSXMAT00000002225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVRIIRGLEDLVASGSQLVWSLAHETLRTWYSRGLIPCRRLLESWFKMGKCYQMTEGRV
CQIHLLDGRKLELLVQPKLLSRELLDLVASHFTLKEKEYFGLCFIDDIGQNNWLQLDRKV
LDHAFSKTSGPLEIKFLVRFYVVKITLLKENTTVELFYLNAKSLVFNETIEVESEHVFKL
AAFALQEAKGDYSSAETTASDLKQLPVLPTRVLREHPSLNYCEERVIEHYKKLKGVTRGQ
AIVKYLALVESLPTYGVHYYPVKDKQGIPWWLGVSYKGIGQYDLQDKLKPRKLFQWKQLE
NLYFREKKFAVEVNDPHRRTVTKRTFGQAGLVIHSWYASHSLIKTIWAMAISQHQFYLDM
KQTKSNMTTTRSSSDIAVDLTELNIPRISKLSNDPLIMASNGSLISTGSADSEVSEEQKK
EKIAELKKKEKDLQDKLTQKLEELKKICMREAEITGKLPKEYPLATGEKAPPVRRRVGTT
FKLDDLNLYDKDPHLRNLESKRALQQKIVEAAERLLKEDGLDKTVKRKRRNNHLDSKRKL
EDIEREINNYKIGARLAPRGSLISADDAQCSELSSLSGSLTLDDDDELGSQRERSRSVQY
SPRPHHAVTLDIFHNKDRRPSANVPLPAGSSRLNYDPVQESLHYSHIDGVSSSNSPLRRP
CDARSMPPTPLLTRNAYSSTQLRSEDAAQHFHQRSGSLESLSQLMMETKPPVPCITVSAA
RRCNSTEVIDDGSSHTSQSSVEYSAPGNHTQRRRTRGRHRNDLYANTGSMPNLAQSDTRF
YTYQPQGRPNTTAYYVTGYPNHLEPEPYTNRVYMYEDELEGHYNVNPSYHHYHHAQQGYY
GHDVHPQYGSDVTDCLSHNVYATIRPPRNRQAPRGTEQVSRSIPKALVVEHLKGWYQRNA
PQKQGTHHCDYNRGSQHSLSYQTMPAPYPHNHRNMYYSSVSSASSSSGNWHMSNRGMSDY
DMPMHESFSCSYSTAPYGHPTHSRSTVDVSHMDSQMNNQTHGTEPEEQIFWHEGSKPGTI
V
Download sequence
Identical sequences M3ZJ28
ENSXMAP00000002220 ENSXMAP00000002220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]