SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000002816 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000002816
Domain Number 1 Region: 634-889
Classification Level Classification E-value
Superfamily YWTD domain 9.81e-56
Family YWTD domain 0.00000351
Further Details:      
 
Domain Number 2 Region: 21-281
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-53
Family YWTD domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 333-571
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-51
Family YWTD domain 0.00000331
Further Details:      
 
Domain Number 4 Region: 935-1191
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-43
Family YWTD domain 0.000016
Further Details:      
 
Domain Number 5 Region: 1323-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000009
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 1242-1280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 590-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 8 Region: 891-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 1282-1317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 10 Region: 287-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000149
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1200-1252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000325
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000002816   Gene: ENSXMAG00000002781   Transcript: ENSXMAT00000002821
Sequence length 1610
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556937.1:55814:78931:-1 gene:ENSXMAG00000002781 transcript:ENSXMAT00000002821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMCLRILLLLGSCWLVSGEPLLLYANRRDLRLVDAARDKANATVVVGGLEDAAAVDYVY
AQGLIYWSDVSEEAIKRTSFNRTGAGAAQTVVPGLAAPDGLACDWLGLKLYWTDSDTNRI
EVAELDGSLRKVLFWQELDQPRAIALDPERGFMYWTDWGEVPKIERAGMDGTNRSLLVDQ
DIHWPNGLTVDYGQQKLYWADAKHNFIHRCNLDGSSREVVVKGELPHPFALTLYEDTLFW
TDWNTHSIHSCRKQTGRDQRIVHSHIFSPMDLHVFSPKRQPVSRSSPCSHGNAGCSHLCL
LSPSRPFYRCACPTGVQLLEDGQTCRDGATQMLLLARRTDLRQISLDTPDFTDVILQVDD
IRHAIAIDYDPVDGYVYWTDDDVKAIRRARLDGSDAQFVVTSQVSHPDGIAVDWIARNLY
WTDTGTDRIEVTRLDGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLDG
LERLVMVNTSLGWPNGLALDYEQRQIYWGDAKTDKIEVMNMNGTGRRVLVEDKLPHIFGF
SLLGDFVYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATHLHRAAGTNPCADSNGG
CSHLCLHTPQGVRCGCPNGLELLGDLQSCIVPEAFLLFSRHTDIRRISLETNSNTMAIPL
TGVKEASALDFDITDNRIYWTDITLKTISRAFMNGSALEHVVQFGLDYPEGMAVDWLGKN
LYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPVEGYMYWTEWGGKPKIDRAAM
DGTGRITLVSNVGRANGLTIDYAERRLYWADLDTTLIESSNMLGKEREVIADDLPHPFGL
TQYQDYIYWTDWSHRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQAGWNACASTNG
HCSHLCLAVPSSFVCGCPAHFSLNLDNKTCSAPTAFLLFSQKAAINRMVIDEQQSPDIVL
PIQNLKNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQTVTVVSSSLLGPFDLSIDIFS
RFIYWTSEVTNVINVTRTDGSRVGVVLRGEHDKPRAIVVNPERGYMYFTNLQDRSPKIER
AALDGTEREVLFFSNLGKPVALAVDNEAGKLFWVDSDLRRIESSDLSGANRIVIADSNIL
QPVGLTVFGKHLYWIDKQQQMIERIDKTTREDRTKVQARVASLSDIHAVHEIDMNEYRNH
PCTRDNGGCSHICIVKGDGTTRCSCPVHLVLLSNELTCGEPPTCSPDQFACVSGEVDCIP
NTWRCDGFPECDDHSDEKECPVCSESEFQCDSRQCVGQSERCNGEVNCQDGSDENKCEDD
PVRCLADQFSCANGQCIGIHQKCDHNTDCSDNSDEMDCYPPELPAPTNSTISSIVAVVMA
LFVVGAIYFVCQRVLCPHMKDDGETVANDFVVHGQASVPLGYVPHPGSLSSSLPGMSRGK
SVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQYTLEFG
YSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRPLKSAAVKGYTSDLNYD
SEPFPPPPTPRSQYLSAEENCESCPPSPYIERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences M3ZKS4
ENSXMAP00000002816 ENSXMAP00000002816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]