SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000003837 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000003837
Domain Number 1 Region: 62-146
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000000000405
Family Apolipoprotein 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000003837
Domain Number - Region: 162-293
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000327
Family Apolipoprotein A-I 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000003837   Gene: ENSXMAG00000003831   Transcript: ENSXMAT00000003842
Sequence length 331
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556770.1:44802:47792:1 gene:ENSXMAG00000003831 transcript:ENSXMAT00000003842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIWELMVVTLSLSTALAHPLHSDSREAAWVDSKANHVFDKTDLSKDTHGIYKSVIDSSGL
YTLESDDLKHPLAEEMQRKLTLESERLRVRLRQELAELRERLSPSPAQLNAILDSMKERL
SPLTQQLQDSLSSNTQDLCSQLRLYLQGLEKTVAQAEASPAFYQEAFQWISQNLELSSGQ
LSSLISDFQTSASGVIEHLKQKSDAEEDTVGSEVWQAVVSKLGQEVSSLREEVQSRVGVF
RAQLAALLESAHPPQTNVADGLEQFCHNAALQSQALQARMERLFIAVEEEVGGASTVSQP
LSSSMQEGASLREDFSVRLSALIQDIMHSVQ
Download sequence
Identical sequences M3ZNP4
ENSXMAP00000003837 ENSXMAP00000003837 XP_014326153.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]