SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005774 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005774
Domain Number 1 Region: 519-551,631-705
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000353
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005774   Gene: ENSXMAG00000005706   Transcript: ENSXMAT00000005780
Sequence length 757
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557991.1:23881:37399:1 gene:ENSXMAG00000005706 transcript:ENSXMAT00000005780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRAGAGHYVVTRPLYSEDSFNEEHKKVYRHRKTILDHVKQYFRCDSKRAKNAALSLLPI
IGWMKIYRFKEWLLSDIVSGVSTGLVAVLQGLAYCLLASLPPWYGLFAAFFPIITYFFLG
TSRHISVGPFPVLCLMIGSVVTRLIPDEGPAANITGFTSLTVDEQRVLVASSVTFLVGIM
QLAMGVLQVGFVVMYLSDTLVSGFTTAAAIHILVSQLKFVLGLQVPGISGPLSLIYTLEI
IFKKITSSNVCDIVISLVIMVVVFLVKELNDRYKSKLPVPIPIEVIMTVITCGVSYAFDF
KTRFGIDIVGKIPRGYEPPVAPNLQVFQHTAMEAFPMAIVGFAVAFSVAKVYSIKHDYTI
DGNQELIAFGVSNIFGASFKAFAASTALSRSAVQESTGGKTQIAGLLSAIIVMIVTLAIG
FLLEPLPKSVLGAVVIINLKGMLMQFNEIPYLWRRDRPDCVVWMITCGASILLGLDLGLA
VGLGVELICVVLRVQFPRCSVLANIEGTDIYKDRKDYICINEPEGVKIFRIPSPIFFANM
DFFRNKLVESLGFNPLRVLKKRNKALSRIRKLLKKGDLQWTSKGFMNTTNSSLTDPLEDS
DNEELDKPIDFKDLPIRIDWNAELPANMVVPRVDIHSLVLDFAAVSFLDISGLKGLKTLL
KELVRVEVEVYIVACDPYILEKLHSCCFFDEEVQPSMFFLTLHDAMLHILEKHPETTCDC
YNTQSPHILTTVTVHHPSRSLRSRDKNGPVPAGETKF
Download sequence
Identical sequences M3ZU81
ENSXMAP00000005774 ENSXMAP00000005774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]