SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005776 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005776
Domain Number 1 Region: 237-378
Classification Level Classification E-value
Superfamily PH domain-like 2.43e-39
Family Third domain of FERM 0.00000987
Further Details:      
 
Domain Number 2 Region: 133-238
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-36
Family Second domain of FERM 0.00000369
Further Details:      
 
Domain Number 3 Region: 55-132
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-25
Family First domain of FERM 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005776   Gene: ENSXMAG00000005766   Transcript: ENSXMAT00000005782
Sequence length 873
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556905.1:52771:105743:1 gene:ENSXMAG00000005766 transcript:ENSXMAT00000005782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDSSSDNKMAKQEQNSKHQDEHREAEDTSEKTSPNKNLKSPQKGSKRLKTSTFKVALLD
SSEYEGEIEKHSKGQTLMDMVCEHLNLLEKDYFGLTFADTESQKNWLDPSKEIKKQMRNS
PWQFAFAVKFYPPDPSQLTEDITRYYLCLQLRDDILSGRLPCSFVTHALLGSYAIQAELG
DYDLDDHGSDYVGDFRFAPNQTRELEERVMDLHRTYKGMTPAEAEMNFLENAKKLSMYGV
DLHHAKDSEGIEIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQ
FESTIGFKLPNHRAAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQ
ASALIDRPAPHFERSASRRYLLSRSLDGEFSRPVSSMCENHDGLSRRSASEQRRLRSPSV
DEQEQEAELELEPSLEQDEDDRDPDQSQDMEQDKDQDSNTTPSRKREIREEAGSPADSKQ
ELSQLDQETTPRHKKEFLDKSQDVLLRHQASINELKRALREPNSKLMAREKRLSATSPTG
TPEKKALGGRSVGKDAVNSPSVEGFVQKALVTSPEEPVSTPAIYEEPFGDLKKESGERRP
LPGLASEEEQERDTVASMRDTQLGIERKCSSMTVSSTSSLEAEVDFTVITDLHSGTEDFS
KGGSEFGERERQPEVGREDFEETSRFYSARLMGSRDKFPMEDRLPEEGTHHEPPVARKDA
SAVSVAHKLKRADTRTETHTNGSEVHQNITDVSPQSPAAVSSQETPAAPKENGSPVKASP
QGRESVVSPLTITAESITSATTTQVTKTVKGGYSETRIEKRIIITGDDDVDQHQALAMAI
QEAKQQHPDMLVTKAVVIRETESPTEEQRRTES
Download sequence
Identical sequences M3ZU83
ENSXMAP00000005776 ENSXMAP00000005776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]