SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007057 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007057
Domain Number 1 Region: 388-530
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-38
Family Third domain of FERM 0.0000151
Further Details:      
 
Domain Number 2 Region: 283-389
Classification Level Classification E-value
Superfamily Second domain of FERM 3.14e-33
Family Second domain of FERM 0.00000519
Further Details:      
 
Domain Number 3 Region: 202-282
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-23
Family First domain of FERM 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007057   Gene: ENSXMAG00000007004   Transcript: ENSXMAT00000007065
Sequence length 977
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556881.1:253844:306711:-1 gene:ENSXMAG00000007004 transcript:ENSXMAT00000007065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEAGSETEVKEKAEESPAQPDQSETAKEESQEIANVEGEEKEKGKEKEKEGKEGKGIT
RYLPTWFKKQKSQSQTSPTKEVPATEEPVSKGVEGEEEPAPEVNGHAEEVEEKEEVKSEE
VNVFKIQPSRPPLAKEEKVEDTTSKSPEKTKETADGEGAEEEEKKKEPEGHVEAETDGGE
NQTSIFQSPLRLVRKNKMKVVVCHVTLLDGTDFTCEVEQKRAKGQYLFFKVCEHLNLLEK
DYFGLMYKDNHDEKCWLDPTKEIKRQIRSNNWQFAFGVKFYPPDPSQLTEDITRYLLCLQ
LREDVASGRLPCSFVTHALLGSYTLQAELGDHEPDQPRPLDFISQLTFAPNQNKEMEEKI
LELHKSHRGMTPAQADLQFLENAKKLSMYGVDLHHAKDSEAVDIMLGVCANGLLVYKDRL
RINRFAWPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFF
RLNAPEPPTKARFLTLGSKFRYSGRTQAQTRLASSLIDRPAPSFERTSSKRISRSLDGAK
PSSDLTSSIPDFSHTPRPDPVLLGDRRLQSKKDSFACVCQPRGKQSPLRVHGDNIYVRHS
NLMLEDLDKTQDEVLKHQASISQLKRSFMEAPPPSPPQPNQWEKRLTSSPATIRVQQQQV
ETVVIQEVSRAPKPVVVTVTADPPAASPTEHEPQDQKVKVEEEAVVVEEVSPAKPEKASS
DSESEEEAEYHPNVPASISQSQIPEGKEEEEQMKEEEEEQKQASAPVVPSLPVEVSQPAS
APVVPSLPVEVTPEEEPEGLMLPEESAEAAPTEEPEQPKMNGEASLVEVDPRPQVICCSE
PPVVKTEMVTISDTFAAQKTEIATKEVPIVHTETKTITYEAAQLDGNGDGEPGVLMTAQT
ITSESLCTTTTTHITKTLKGGLSETRIEKRIVITGDCDIDHDQALAQAIKEAKEQHPDMS
VTRVVVHKETELAEEED
Download sequence
Identical sequences M3ZXW3
ENSXMAP00000007057 ENSXMAP00000007057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]