SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007145 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007145
Domain Number 1 Region: 350-439
Classification Level Classification E-value
Superfamily TAFH domain-like 3.01e-35
Family TAFH domain-like 0.0000392
Further Details:      
 
Domain Number 2 Region: 635-683
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000209
Family TBP-associated factors, TAFs 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007145   Gene: ENSXMAG00000007128   Transcript: ENSXMAT00000007153
Sequence length 848
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556666.1:4538762:4555925:1 gene:ENSXMAG00000007128 transcript:ENSXMAT00000007153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATGAPSLTALPVPVTLSSQPAASFPRAAVLAPSPPLNGSTGAGKVEGSPVAPPPGATLAS
QPGLPAPQSPAGSPAVTLQGLPSPVISTAQNGLDPKGSASLSAAQVLNHNNPLMHTKMLV
TSTPAPPAAQASIIQTQTASSTPLAAAKPAINGVAQTGVRPPGAAVGAAASIQPQRPQLV
TATTRPAAPQTALAVRPQQQTTIQLPPGFTIPPGMVLVRTETGQLVLVPQQALAQAQAKL
QQSQTVVTQRPATPLATSTIRVSTTTTAPGAPQAVRLAAPAPTRIVQSPSTTSVQPLTVP
AAGAVKMPPPQKTSTVITAGVTPTAKPTTLPGGGATPPPAAPPGSRVTVVSQEMQENVKK
CKNFLSTLIKLASHNSPSPDTSKNVKTLVQDLLDAKIEPEEFTSRLQAELKSSPQPYLIP
FLKKSLPALRQTLLNSQQSLTTAPPTTSAPPPVAPGSLTAAAIRPRLPVNATGTTVRLTP
PITNTVTLSNLSFTALAVGRPTVQTIQTRSPVVLSQQIRHPGEARCFVLKLTKNWVTEIL
DVQFILSLLQNVEYYKTTLLRGPTTMAGKAPVHLAAQANQKKPTDPGGGTFRDDDDINDV
ASMAGVNLNEENARILATSSELVGTKIRSCKDESFLPPGLLHRRILDSAKKLGVTEVPLE
VVNLISHATESRLRSLLEKASVIAQHRTDGAKDEGNLTYEQSSDVRSQLRFFEALERMEK
QRKDEQEREMLLKAAKSRARQEDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPR
KKRKLDSGGGASASSEVTSGSGSGSSASSSRQQLRQRITRVNLRDFILCLEQDRSTARSL
MLYKALLK
Download sequence
Identical sequences M3ZY51
ENSXMAP00000007145 ENSXMAP00000007145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]