SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008295 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008295
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily POZ domain 6.8e-26
Family BTB/POZ domain 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008295   Gene: ENSXMAG00000008273   Transcript: ENSXMAT00000008306
Sequence length 163
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556844.1:652544:658703:-1 gene:ENSXMAG00000008273 transcript:ENSXMAT00000008306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences A0A087XJD4 A0A0N8K365 A0A1A7YCN9 A0A1A7ZXY7 A0A1A8DK51 A0A1A8F2A6 A0A1A8JWP3 A0A1A8NMB1 A0A1A8PMY1 A0A289YPJ2 B5X9I6 C1BF33 C3KJ96 G3QCJ8 H2L5T3 I3KKY2 M4A1F1 Q5SUR3 Q6PEC4 Q9WTX5 W5MVY0
ENSXMAP00000008295 ENSONIP00000021777 ENSRNOP00000007676 ENSORLP00000001170 ENSONIP00000021777 ENSGMOP00000017446 ENSPFOP00000005887 ENSRNOP00000007676 ENSGMOP00000017446 ENSORLP00000001170 10090.ENSMUSP00000104700 10116.ENSRNOP00000007676 69293.ENSGACP00000027614 8090.ENSORLP00000001170 ENSGACP00000027613 ENSGACP00000027614 ENSXMAP00000008295 ENSMUSP00000038744 ENSMUSP00000104700 ENSMUSP00000038744 ENSGACP00000027613 ENSMUSP00000038744 NP_001007609.1.100692 NP_001007609.1.4139 NP_001134437.1.97760 NP_035673.3.92730 XP_003451485.1.78416 XP_004076110.1.28442 XP_004561815.1.88231 XP_005727769.1.53837 XP_005727770.1.53837 XP_005727771.1.53837 XP_005727772.1.53837 XP_005807250.1.87360 XP_005923157.1.24487 XP_005923158.1.24487 XP_005923159.1.24487 XP_006532849.1.92730 XP_006631848.1.81211 XP_006785086.1.46954 XP_007577635.1.10163 XP_008303474.1.38333 XP_010736004.1.61708 XP_010782934.1.77114 XP_012736955.1.37407 XP_012777492.1.88231 XP_013992356.1.97760 XP_014189297.1.24487 XP_014840662.1.96476 XP_014871142.1.100837 XP_015205011.1.81211 XP_015232015.1.42780 XP_015816973.1.37898 XP_017275402.1.84151 XP_017275403.1.84151 XP_018547425.1.34915 XP_018607285.1.37976 XP_018607286.1.37976 XP_019725124.1.30352 XP_019952762.1.63745 XP_020320600.1.87700 XP_020341466.1.87700 XP_020467597.1.23826 XP_020467598.1.23826 XP_020491276.1.8198 XP_020773576.1.12261 XP_021068302.1.100879 XP_021473196.1.32639 XP_021479750.1.32639 XP_022046621.1.10920 XP_022046622.1.10920 ENSLOCP00000012539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]