SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010376 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010376
Domain Number 1 Region: 398-540
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-38
Family Third domain of FERM 0.00000661
Further Details:      
 
Domain Number 2 Region: 294-399
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-31
Family Second domain of FERM 0.0000031
Further Details:      
 
Domain Number 3 Region: 213-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.41e-24
Family First domain of FERM 0.0000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010376   Gene: ENSXMAG00000010314   Transcript: ENSXMAT00000010390
Sequence length 845
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556687.1:657769:683860:-1 gene:ENSXMAG00000010314 transcript:ENSXMAT00000010390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEASAVNEADTEGKQKSSRAPPEAESVQQETTATEQEGEQSSKKAQEQAAEPGPVDVA
TSPEEEQLKPRTRTSAGKGLSRLFSSFLKRRSQCSDEQKEEEKGKKREKGKDKGKKEDKE
ENKPSEEQVKAPIAAPEPELKLELDTEQAGDHQSVSSAETQPAPEEQKEEPKQEVTKGEE
KTTEKTKKEKPPKQKKTEKKAEEAKGPKRPKAMQCKVTLLDDTLFECELDKHAKGQELLT
KVCDHVNLLEKDYFGLAIWETPTGKTWLEPIKEIRKQVSGGVYEFTFNVKFYPPDPAQLT
EDLTRYFLCLQLRKDIMQGVLPCSFVTLSLLGSYTAQSELGEYDPEVHGTDYVKDLNLAP
GQSKELEEKVMELHRTYRSMSPAQADLLFLENAKKLAMYGVDLHQAKDLDGVDITLGVCS
SGLMVYKDKLRINRFPWPKVLKISYKRSSFFIKIRASEQEQYESTIGFKLPNYKASKKLW
KVCVEHHTFFRVPSVEPPSSRRFLALGSKFRYSGRTQAQTRQASSMIDRPAPRFTRSASK
RLSRNLDGGRAKVVSTQRGTRPVSAPVFSQAALADAGIPMAPFDQPQTSTPIKTSRLEER
KLEVTVEAAEPSKIEAVSEVKVHNIVKYSVNPESESERTIMEGVQMRKKRAKKIEGDSIY
IRHSLLMLEEFDKPQEDLLKHHASISELKRNFMEAVPEPRQSEWDKRLSTHSPFRTLGIN
GQPLPSADGPPLVQTHTVTITAVSNSLPGDISTTEVPIVPTKTFTYESSKMTDDGTDEDK
DSSFSTSKTISSETSSGTTVTTTTTHISKVVKSGSSETRVEKRIVITADSDVDQEKEKHG
GASAL
Download sequence
Identical sequences M4A7D2
ENSXMAP00000010376 ENSXMAP00000010376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]