SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000014360 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000014360
Domain Number 1 Region: 161-266
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-35
Family Second domain of FERM 0.00000632
Further Details:      
 
Domain Number 2 Region: 81-160
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.74e-23
Family First domain of FERM 0.0000857
Further Details:      
 
Domain Number 3 Region: 265-410
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000169
Family Third domain of FERM 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000014360   Gene: ENSXMAG00000014334   Transcript: ENSXMAT00000014380
Sequence length 664
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557600.1:213:8328:-1 gene:ENSXMAG00000014334 transcript:ENSXMAT00000014380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEPSEAQPPEAEPFPEVAAHSTPKQVTGLRPRMTSDLRPAGAEGPAQSSLAEDSSSLL
SSGGRVARSPARTALGFRTMQTRVALLDGSQFTCIVEKRSRGLQLFEKVCDHLNLLERDY
FSLSFRDADSNKNWLDPAKEIKKQVRGVPWNFSFNVKFYPPNPAQLSEDITRYFLCLQLR
QDVVSGRLPCSFATHAVLGSYTVQSELGDYDSDECAPDYVSELCFAPNQTKEMEAKIMDL
HRTLRGMSPAEAEMHFLENVKKLSMYGVDLHHAKASDWFLSEPIGASLGVQQSPFVLQDI
LLANLQFKDVSVSVGWSTCRFYIKIRPGEFDQFESIIGFKLLNHRAAKRLWKVCVEHHSF
FRLLSPEEPPKKFLSLGSKFRYSGRTQIQSRRASAQISRPAPNFPRCISKRNMLSRSLDG
DMGSGLYAASKAIAVSDHIATVTRTLDDRREEPGKNLANQEELDGSQCLIKGTRTPVQPM
KVLVLVPVEEVLLLLVQEEQKEEQKEERKTIEVSPESPPSPQKHDTKTELTDTVVDGDLT
VTESDQDEDLKTQETLGSPEDIVQTSISALRRSFLEGEQGGGGMTEWDKRLAASPLRRAD
DAPMIEPLEPEEVSGSTGVNLGSTGGPVQVSMSMSSPQSVSPVQPKPSFDEISPELTALL
KSTR
Download sequence
Identical sequences M4AIR6
ENSXMAP00000014360 ENSXMAP00000014360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]