SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015520 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015520
Domain Number 1 Region: 367-460
Classification Level Classification E-value
Superfamily TAFH domain-like 1.83e-33
Family TAFH domain-like 0.00000739
Further Details:      
 
Domain Number 2 Region: 641-687
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000036
Family TBP-associated factors, TAFs 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015520   Gene: ENSXMAG00000015488   Transcript: ENSXMAT00000015543
Sequence length 853
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH557073.1:32937:46722:1 gene:ENSXMAG00000015488 transcript:ENSXMAT00000015543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGTAGITSAAETIPTAAKSHFGSLTTSGAVTGASGATAGGDKQQATGAPALDGNGAVMN
CHIPGSGQSDSSQTAVVNGPASASPGFIIRTNPSAQNTSTSSGSSSQPAEKTVPTVALVR
PPMQTSANETQSTESPNTVLSSGSGSVSCKTEPTKNITQAGAQVLPSGVLSATMRNPTVL
QNLRTTLSSTISAAPPGGIRSIAPQVLAPRLTQPQQNATSIQNIQIPAGMVLVRSESGQL
LMIHQQTLAQMQAQAQSQSATTPRPAAPPSTPPVQVTSLQTPGGPLLARSVTPTTIIKQG
SPVQTTVATTTTLQRPPVLQNTIILGGNATSTGQALGTPTTVQATAAVTQRVGPLGVTGV
PVTPTTITAETLENVKKCGNFLSTLIKLASNGKQSSETTATVKELVRNLLEGKIEPEDFT
SRLYKELNSSPQPYLVPFLKRSLPALRQMTPDPEAFIQQSLLPQPSSQPAAATSPALGAV
VLRPSLSPAVSAATGSTTTKATVITLSQKANSKPGLVVAQQQVRPQVTLAQSPLVTIRGA
APSRIIVGQPQMVRHTPQGSVVKQNVAPGTRGVQLLNQASLVDAQRNKLKEAGGGTFKDD
DDINDVASMAGVNLSEENARIMASSSELVGIVTRSCKDEAFLSISSLTRIVLQIGKKFGV
SELGTDVINYISHATQQRLQNLLESASQVAQLKNLNFKEDERCEQVSDVRAQLKFFEQLD
QMEKQRKEEQEREILLKAAKSRSRQEDPEQLRLKQKAKEMQQLELAQIRQREANLTALAA
IGPRKKRRTDSPLSASAEGSGLGSSQPGGSSGQGSRQFMRQRITRVNLRDLLLCLENDRD
SSHSQLLYKGLLK
Download sequence
Identical sequences M4AM26
ENSXMAP00000015520 ENSXMAP00000015520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]