SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016565 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016565
Domain Number 1 Region: 610-706
Classification Level Classification E-value
Superfamily TAFH domain-like 8.24e-35
Family TAFH domain-like 0.0000442
Further Details:      
 
Domain Number 2 Region: 856-904
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000314
Family TBP-associated factors, TAFs 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016565   Gene: ENSXMAG00000016531   Transcript: ENSXMAT00000016589
Sequence length 1015
Comment pep:novel scaffold:Xipmac4.4.2:JH556668.1:1414090:1555732:1 gene:ENSXMAG00000016531 transcript:ENSXMAT00000016589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASDPLEDMLFSEVDEKAVSDLVGSLESQLSGQSNSAGKADENGGAGSVAPANHHLGK
TLPAPVSTTTLEQQQQPGRWNKPEMRQEVNSKDASPDKTVTSPSLSCSSSFGEPPSTSAG
CVNATSSGIQSHGASITPLTASGVSTLASPQDSISTTSSRSASVSQCTGEAPAEASAPRK
RVATPRRSPSARIKSLNGAAVTTRRSSITAVTDSSIISSVDPGATPPNSTRSAINTSTFT
LSNANLPVGQSAIALDRGTPTIALHRLPSHIVASIAQNGNGTSVSALVQQGARIEPATSS
SPTGDLSKAATDTGASKTDDCQSNIVTQSQVGSVSSVINTLLPSASCAITPATTTTAAPT
TTTVTQPLSSATTAVCATAIATTSVCGTVQTTAVTSTMSIVRPTAPSPTPVVATPTLSQP
RPGVPTPQRIVAPQLIVRPSQQQTTIQLPPGFTIPQGMVLVRTELGQLVLVPQQALAQAQ
AQAQAQNNISPRPAAPTTGTSFRVTTPQQSPATSQTTRPCPLTPAKMAPSPSPTPSSPAL
QTSSSSSSSSSCPALRPKGPVAPTVVVTAPQQTPMVMTPQAQAQPTSQPAAQTQTSVAAA
PGAPVVSQEMQENVKKCKNFLATLIKLASHNSPSPETSKNVKALVQDLLDAKIEPEEFTS
RLQSELKSSPQPYLVPFLKKSLPALRLSLLNSQQSLTQPLQQGVKPAAGGTPPAMVAGPA
VRIRHPNSVSTTAGASVLPAGTIGHAAAMGVKTGGTVSGPVRMPMVITQSIRPQGMIGKG
AIIQAGKSPMGLPVQISGNQKNKLNDPGGGSFRDDDDINDVASMAGVNLNEESARILATN
SELVGTQIRSCKDEAFLQPGLLHRRILETAKKFGVTEVPMEAVTFISHAAQSRLRTVVQK
VSIIAQHRIDSCKDDECYEQSADVRSQLRFFEQLERIEKQRKDEQEREILLKAAKSRSRQ
EDPEQARLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKLDSPGATPSGTE
Download sequence
Identical sequences M4AQ20
ENSXMAP00000016565 ENSXMAP00000016565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]