SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016666 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016666
Domain Number 1 Region: 31-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.72e-78
Family Calponin-homology domain, CH-domain 0.000078
Further Details:      
 
Domain Number 2 Region: 1085-1199
Classification Level Classification E-value
Superfamily E set domains 3e-36
Family Filamin repeat (rod domain) 0.0000037
Further Details:      
 
Domain Number 3 Region: 1373-1488
Classification Level Classification E-value
Superfamily E set domains 3.18e-36
Family Filamin repeat (rod domain) 0.0000142
Further Details:      
 
Domain Number 4 Region: 1563-1681
Classification Level Classification E-value
Superfamily E set domains 5.54e-33
Family Filamin repeat (rod domain) 0.00000805
Further Details:      
 
Domain Number 5 Region: 1178-1295
Classification Level Classification E-value
Superfamily E set domains 4.94e-31
Family Filamin repeat (rod domain) 0.0000935
Further Details:      
 
Domain Number 6 Region: 1487-1596
Classification Level Classification E-value
Superfamily E set domains 9.81e-31
Family Filamin repeat (rod domain) 0.0000274
Further Details:      
 
Domain Number 7 Region: 518-627
Classification Level Classification E-value
Superfamily E set domains 5.14e-30
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 8 Region: 1865-1959
Classification Level Classification E-value
Superfamily E set domains 9.34e-30
Family Filamin repeat (rod domain) 0.00000885
Further Details:      
 
Domain Number 9 Region: 797-908
Classification Level Classification E-value
Superfamily E set domains 2.14e-28
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 10 Region: 1284-1395
Classification Level Classification E-value
Superfamily E set domains 3.8e-28
Family Filamin repeat (rod domain) 0.0000345
Further Details:      
 
Domain Number 11 Region: 713-821
Classification Level Classification E-value
Superfamily E set domains 1.15e-27
Family Filamin repeat (rod domain) 0.00069
Further Details:      
 
Domain Number 12 Region: 2329-2420
Classification Level Classification E-value
Superfamily E set domains 4.2e-27
Family Filamin repeat (rod domain) 0.0000074
Further Details:      
 
Domain Number 13 Region: 901-1011
Classification Level Classification E-value
Superfamily E set domains 5.8e-27
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 14 Region: 2051-2145
Classification Level Classification E-value
Superfamily E set domains 5.42e-26
Family Filamin repeat (rod domain) 0.0000251
Further Details:      
 
Domain Number 15 Region: 283-378
Classification Level Classification E-value
Superfamily E set domains 1e-25
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 16 Region: 605-707
Classification Level Classification E-value
Superfamily E set domains 3.34e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 17 Region: 2655-2746
Classification Level Classification E-value
Superfamily E set domains 1e-24
Family Filamin repeat (rod domain) 0.0000106
Further Details:      
 
Domain Number 18 Region: 2521-2612
Classification Level Classification E-value
Superfamily E set domains 2.27e-23
Family Filamin repeat (rod domain) 0.00000936
Further Details:      
 
Domain Number 19 Region: 379-480
Classification Level Classification E-value
Superfamily E set domains 2.6e-23
Family Filamin repeat (rod domain) 0.00071
Further Details:      
 
Domain Number 20 Region: 1670-1780
Classification Level Classification E-value
Superfamily E set domains 6.07e-22
Family Filamin repeat (rod domain) 0.0000723
Further Details:      
 
Domain Number 21 Region: 999-1102
Classification Level Classification E-value
Superfamily E set domains 7.34e-22
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 22 Region: 2263-2344
Classification Level Classification E-value
Superfamily E set domains 2.2e-21
Family Filamin repeat (rod domain) 0.00019
Further Details:      
 
Domain Number 23 Region: 2428-2517
Classification Level Classification E-value
Superfamily E set domains 1e-20
Family Filamin repeat (rod domain) 0.0000183
Further Details:      
 
Domain Number 24 Region: 1795-1880
Classification Level Classification E-value
Superfamily E set domains 1.33e-17
Family Filamin repeat (rod domain) 0.0000672
Further Details:      
 
Domain Number 25 Region: 1967-2047
Classification Level Classification E-value
Superfamily E set domains 1.6e-16
Family Filamin repeat (rod domain) 0.0000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016666   Gene: ENSXMAG00000016525   Transcript: ENSXMAT00000016690
Sequence length 2747
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556669.1:2722657:2752444:-1 gene:ENSXMAG00000016525 transcript:ENSXMAT00000016690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSNNYGEDQLPPQYYQATDFGDEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKC
VNKTITDLQRDFSDGLKLISLLEVLSQKKMYRKHHNRPNFRQMKLENVSVALEFLDREHI
KLVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNK
VPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWAGWDPNQPVQNAREAMQQADDWLGVP
QVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPLKPKQLFPDKVKAYGPGIEPHGNKV
LQPAVFTVETLEAGSGEVLVFVEDPEGHKEEAKVKPNKNKNGTYTVTYLPKVEGVHKVKV
LFAGQDIDKSPYSVNVAKAMGDPSKVHARGPGLDATGNMANKPTYFDIYTAGSGAGTGDI
SVVIVDPQGKKDTVELILENKGDSVFRCTYRPVLEGPHAIHVLFAGQEIPKSPFNVNIAE
APAVAPPPGAPLQIAPQSVRTPPGAKGVPPSKPGRPTINPNACRATGRGLQPKGVRVKEV
ADFKVFTKGAGSGALNVSVKGPTGAEEQVKVRDAGNGVYECEYYPLTPGKYTVSITWGGQ
PIARSPFEVEVGDEAGFQKVRAWGPGLKTGMVGKSADFVVEAIGTEVGTLGFSIEGPSQA
KIECDDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDSPFMAHILPAVNDVLPRKVKAYG
PGLQPTGVIVNKSTDFTIDARMAGKGHLKIYAQDAEGCTFNIKITDRGDSTFVCAYTPVK
PIKHTIIITWGEVNVPNSPFRVLVGEGCHPDKVKVYGPGVEKTGLKANEPTYFTVDCSEA
GQGDISIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYTPPGPGRYTIMVLFADQEIPI
SPFKVKVDPCHDAGKVRAEGPGLNKTGVEVGNPTHFTVYTKGAGKAKPEVHFAASGPGEA
VRDFEIIDNHDYSYTVKYTALQQGNMAISVTHGGDPIPKSPFHITVAPALDIGKVKVEGL
DTKVEVGRDQEFTVNTKGAGGQGNVGVKMTSPSGRPIPCKLESDKAKNTHGVKYIPPEEG
QYKVDVTYDGNPVLGSPFGVEAVMPADPSKVRAFGPGLQGGIVGKPAPFTIDTKGAGAGG
LGLTVEGPCEAKIECQDNGDGTCSVAYLPTEAGEYAINILYAERHIPGSPFKAAVRPAFD
PSKVTASGPGLEKAKAGEPAAFTVDCTRAGDAELTIEIVSETGVKAEVHIQKTSEGTFSV
TYIPSFHGTHTITIKYGGHAIPYFPKVLQVEPSVDTSGVHVYGPGVEPRGVLREVTTHFI
VDARSLSKAGGNRVKVRVVNPSGSNTDTYITDKADGTYRVEYTAFEDGMHLIEVLYDGAP
APKSPFRVFVVEGCDPTRVRAFGPGLEGGITNRPNCFTVETRGAGTGGLGLTIEGASEAK
ISCKDNKDGSCSVEYVPFTPGDYDVNINYGGQPIPGSPFRVPVKDPVDPTKVKCSGPGLG
AGVRAHVPQTFTVDCTQAGQAPLDVKLYGPTGTVEPMGVKNNGDGTHTVHYTPAQDGPYT
VAVKYADQEVPHSPFKVMSQPGHDASKVRASGPGLDTKGVSASLPVEFTIDARDAGEGLL
TVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTITIKYGGDEIPYSPYRIQSLPTG
DASKCRLTVSIGGHGVSSLQKLQTSEDTVITVDAKAAGKGKVTCKVLTPQGMELDMDVVE
NHDGTFDIYYTAPEPGKYVITIRFGGENIPKSPFHVVASNEPVVPRDPVDPLFRPVNFLV
PFTPQQGEITGEVRMPSGKTARPHITDNKDGTITIKYQPTERGLHEMDIKYDGNHIPGSP
LQFYVDAVNSGVVTAYGPGLSYGMVNRAATFTVVTKNAGEGGLSLAVEGPSKAEITCKDN
KDGTCTVSYLPTAPGDYNIIVKFDNKHIPGSPFTAKITGDDTITRTSQLNVGTAADVSLK
IAETDLSSLTASIRAPSGNEEPCLLKRLPNRHLGISFTPKEVGEHEVSVRKNGMHVANSP
FKIMVGQSEIGEASRVKAFGKGLVEAHTFEMAEFFVDTRNAEGYGGLALSIEGPSKVDIN
CEDVEDGTCRVTYCPTEPGSYIVNIKFAEKHIPGSPFTVKVTGEGRIKESITRKRQASSI
ASVGSTCGLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRV
EESTQVGGGGGGGSPFRDVFGDFLGRESLSSFAGITARPEPESGSQAMTAQVTSPSGKTV
DADIVDGGSSTYSVRFIPQEIGPHTVNVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGP
GLERGVAGAPSEFSIWTREAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYVVKEPGDYE
VSIKFNNEHIPDSPFIVPIATLSDEARRLTVTSLQEKDLKVTQEASFMVQRNGARGVVDA
KVHTPSGSSEECYVSDLDGDKSAIRFIPRENGVHSIDVKFNGCHIPGSPFNVRVGDPGLI
ADPGLVTAHGAGLLGGTTGVPSEFVVNTCNAGSGALSVNIDGPSKVKMDCRECPEGYRIT
YTPMAPGNYLITIKYGGPQHIVGSPFKAKITGARLSGGHSLHETSSVLVETVTKTSKVGG
AYSSSSSATSAKLTCDASKVVCRGAGLSKALVGQKNNFTVDCSKAGTNMLMVGVHGPLAP
CEEVYVKHMGNKLYNVTYTVKDKGSYTVIVKWGDDNVPGSPYKVTVP
Download sequence
Identical sequences M4AQC1
ENSXMAP00000016666 ENSXMAP00000016666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]