SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000016902 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000016902
Domain Number 1 Region: 128-233
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-39
Family Second domain of FERM 0.00000329
Further Details:      
 
Domain Number 2 Region: 232-374
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-38
Family Third domain of FERM 0.0000119
Further Details:      
 
Domain Number 3 Region: 48-127
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-24
Family First domain of FERM 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000016902   Gene: ENSXMAG00000016852   Transcript: ENSXMAT00000016926
Sequence length 803
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556901.1:753122:800892:1 gene:ENSXMAG00000016852 transcript:ENSXMAT00000016926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTAVEGDARRTNQVPEDQGELDDSSEKTPSKASRSPQKTTKRLKTVPVKVTLLDGSEYD
TAVEKFAKGQTLLDMVCGHLNLLERDYFGLTFIDSDSSKNWLDPSKEIKKQIRVGSWTFG
FAVKFYPPDPSVLIEDITRYYLCLQLRDDILSGRLPCSFVTHALLGSYTVQAELGDYDPE
EHGPDYVSEFHFAPNQTRELEERVMELHRNYRGMTPAEAEMNFLENAKKLSMYGVDLHHA
KDSEGIDIMLGVSANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTI
GFKLPNHRASKRLWKVCIEHHTFFRLVSPEPPPKGFLVIGSKFRYSGRTQAQTRQASALI
DRPAPQFDRSVSKRYLQPRSIDGGLNSSSVPVCAEDQDQYPDQEAEHQDGQKQPMGAISS
TPTKVLELKDEEPGIPIDTKPESEQQFLDKPEDVLQKHQASINELKRALKQPNTKKVPRE
KRLPSETPPVGTPERKTNLKLGVKEGLLIKKDTPPTPAIHEEHFSESSDDQDQDILYLKE
THLGIERKCSSITVSSTSSLEAEVDFTVLTDLQTGMEEFSRGMSELGERDLSPDGGLRFG
IDLLQQQGPPEPPPPLVSAPLTRGARGSPPAKLIQAEEVRPEVRPEVRPESRPEVRQDVK
RPDGQPVVPKKPKRSVPVSSSVDRVAPLSREASDVMPTPTVRKTDTRTETQPNGSELTTT
IVEFTAENVTSATTHVSKTVKGGYSETRIEKRIIITGDDDVDQEQALAIAIQEAKQQHPD
MQVTKAVVIRETEPSAEDRHGTT
Download sequence
Identical sequences M4AR07
ENSXMAP00000016902 ENSXMAP00000016902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]