SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017799 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017799
Domain Number 1 Region: 321-692
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 6.28e-65
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.011
Further Details:      
 
Domain Number 2 Region: 31-308
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 2.75e-36
Family Lipovitellin-phosvitin complex, superhelical domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017799   Gene: ENSXMAG00000017755   Transcript: ENSXMAT00000017825
Sequence length 3145
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556749.1:1764012:1779716:-1 gene:ENSXMAG00000017755 transcript:ENSXMAT00000017825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVEDKSSIQDKDTAVNLMRQLVNLPETEGERRAHLFHTLISTVRGMKIETLKAALPEV
VPLSRFLTYQVLAQCGTPECSSAIMHILRSFDTSDIEVDAAVFALGLMSNPSALLINDML
KMAKYKPSKPIMYALSNVVKRFHKVEKKTIPEIHSVAEFMASQLGDCTGAKDHTFLTLRV
IGNMAPAVIPVSPALRTAVIQCVKEPAASQMVQQAAIQVYRQIPIPDQTRDVFMQVLLDN
SNPVQERIAAYLIIMKDPQPSELTQLIDALSSEANQQFRSFVISHITNILSSTEPETEDL
RQKIQEALQGNEIGPTMDPIKFSRNYKIGSVQGNMIFEGVSYLPKEVMLEMTLRAFGFEI
DMMEIGMTGEGFEPTIEALFGENGFFPDTALKTIYFVSDNMPQPVNEILENAIPALKRNR
MKRETSNNLVSEVRQNLEKLVNELETAQSPEAMVYLKLLGNELGYLRTNDIEEMTYSAGM
LIDKMLKMFPHEILRSLMTSPDNTISAHYIFMDNEFFLPTVTGVPLRIALSGTFTPGFKG
GLQIARDMSTATFMPFGGIEFVTQVGSYIPEYVNSGLEMHTNIFHESGIRAKVSMGRDHV
KLTIPAPTNPAKLIQITNSFVAIIGSDVKMLPPVVKDKVELNKCTPAFIGMKYCSALQYT
DAFSHETAPYFPLTGDSKFVVELHSTGEVTEYTATVAYKLLKEGDEGRQKVDVLKFILRA
EGAAPTEVQLEMKYNREKNVITADVQIPDFDVEVGLRLGVIDGNTQVKGTHSIFLDFINK
NIPQLSLIARANLKEKKEGMLQVQLLVPSISAESTVTASLKRDDLLELELENEIKVMDAS
SEQKIKMKYDGSKIELEFKSDVDTKTTSLPNGDIIQQYGNKILDMQVAQSDMKVRHIFRK
FVEAANSYMEKYGAEMLPYMQNFRLPNIPDISLPEKLFLNTDAKAIFYFNDDRFTFVIPL
PLGGKTPADLNFPPALTIPTLSIPQFGLDIPARKILMPDIAVPESFTVSVPLFRQVKLST
LINSNLYDVEATLAAGKDVVEPPSYSARFDAKGTSPIDILSVAVEGLGTGMVSITESIKA
HLRSSFTHKLFEASFSTEEDGVISDKFTLKSRTKVEATSQFGINAKLQHTRMTEINTQGI
NVDNNFEGSFKAGPLYGTTTSVQAISVFPFRSEAKIDSKIQLDSTIFKAENQILGTLSNG
EFLVISNTKALEDIFTHVAEISFKESQLTMKCDARAYALGLKINNQAEASAGAGRATIRI
ETNGDYSDNRVYSILMSTFDDNGLTVSCNANIKLFENEVTHEARLKMNKDGLSTSGTTTL
QSPLSLENTFNAGIDASRAILFITNKAAIHDIKVDNSNILTITLSSLDFISKVEAGASEY
ASYNHDIIFGLKPHTASAKINNHLKLLDASFDNDAKLLAEFYKIDLTGKLTALYGVDEIK
HTYQINYADLSANAKYSTTGKVFGTHMSHNTELEIVGLAAKFSNDARFNSQFFRFDHTMR
CNFVPFDFNLDAMFNGDGDITFYGQHSAQLYSKSYLRAQPLALVSSHECRASVTQKLDNR
LSFDTTYDNNIDTVLTPQEQKATFKVKSKMNQHEFSQGVEIYNTHERVGIEVRGTILTNI
INTASTENQDFAISGFLKYDKSTQSHIIQIPLIESLSVFIESIKELIVVVAESLQNFLNK
SEVRARLETLPQEISELIAQINLEDKANQLKQFFNDFSQNFVITRENVDAAWESLRKAIE
TFFINLSSYIQTFSDFLYQNFSQKIENVLEDLNELKAKVVNVIETISELIQQIELEKLKG
SSIEFLSDIEARFQIKAIVQSIVTKVKDRIDEFDFSHLLISSRDMKEILDFFVSHIPVNI
LDNTMTDIKRKIHDFDLVGKINVIFTKMKELVVYLQVDQKAQVVLEKAEDLIKQLRIQET
IQAAVKIVKDSDISSRFIEIFQATTDYLKTTEVNVIIEQFNMYIETMLQKLKSINYNDIV
DNTNLIIEEYRNYSNEIIRTLKISEKLEAAREFANVVLSSIRDFIEHLREIKVAKIVNSA
TDIYEHVIQTFVELVKEEIRNPDIRVKLNEFLNGVNFLFRIGIDIILNNISHVTSKIKEV
LPDEKIVHEISQIIESLLNEVRQAEINVPSFTFPLTDLVVPSTKLKLNSKFEIPAEINMP
EFTILDMYTVKAFTVSFDDINQMIIEFIDFIVNIEIKMPDPDAFFGDLTLNYLPTLPEIT
LPEIPLLEVTFPSIPQVDTEKFAKALEIPEIKLPTIPKEIMLPCFGKLYGEIKFQSPMYT
IKTSAEFQNSTVSMSPSFTGSFSSQGTSPTLEILNYKLDSNARIAIPKMNRVLLAETLTF
KHTSLGVDHQASVTLYGLSAQALAQAQAKTKVKVDTAPYSANLMNTAFIAMAGGMTSTVD
TTYNHVVNIPFADISSDIIATQKSVVQQNGLTLNFEVDSTGKGKINSHDCNHKSKFELSL
NSKTVHLSFTGDTESEILKMKQLITVESGTFSYFKFNVQNEGEAPFIKSSVLEASGLANL
YDMKIEIKAKHDAELYGVDSGVVSNTANFKVHPVEVFFEIQNKANAKASIFKSLNVKIDL
ENDFLVHIRPDFQKVNAAFLARLNQYKIFSNFTADNTRNYAGVLIEVNGETDLFFLEYPI
SIPELDLPLVNFNSPPIDDLNLFKKTGLKNILSSTEQTFNMDAKILYIPKMGKLNSEYSF
KSAIINLNAETLLSAEDDLVFRLGATTTSVFECLNTKLKGTTNVSTKRGIKIANSLSLEN
RYIKGTHDSTYTMNTVSVSTSSIIALPILNLEASQNLIANPYSKPEALSTLKLKGDFNIP
YINAIGKVEAEHTVKVEIDEEYLSVESSFKSNMDSTALKNYLVLGVLDNEAVVYLNTNTV
RSTCKFITDAKLNHGTTKVLAIDVNQQLAAEASMGRLFVELAYSSNNGANSLSFKTEGKH
IAKAIVDFEPSLLKADIEIDIKQPSSLGDLAYFEKTVVELNPSKQKMTTNAKLASPVYNT
NMFTEVEWSAPALKITFRSNATYPNVVLQYDMEGSTTVTFENDFLKVVTNLVLTEPDLNM
DVEHVIVYAWGAVQLKLNVGITSATFTDLRLHYAAHGDLVNVSVSTPSSGFLGLQLDCRD
PSQMSARLYGRSPMSSETDFDILLI
Download sequence
Identical sequences M4ATK4
ENSXMAP00000017799 ENSXMAP00000017799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]