SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000017921 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000017921
Domain Number 1 Region: 407-810
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.17e-137
Family Ankyrin repeat 0.0000000000104
Further Details:      
 
Domain Number 2 Region: 111-425
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.03e-98
Family Ankyrin repeat 0.000000588
Further Details:      
 
Domain Number 3 Region: 1412-1496
Classification Level Classification E-value
Superfamily DEATH domain 7.06e-22
Family DEATH domain, DD 0.0048
Further Details:      
 
Domain Number 4 Region: 15-109
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.4e-20
Family Ankyrin repeat 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000017921   Gene: ENSXMAG00000017872   Transcript: ENSXMAT00000017947
Sequence length 1916
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556662.1:6915562:6965446:1 gene:ENSXMAG00000017872 transcript:ENSXMAT00000017947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPSFFLLLQADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLNGLHLASKEGHVKM
VLELLHNGITLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQRQKGFTPLYMA
AQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALH
IAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKN
GITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRIIEILLDHGAPI
QAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLL
DKGAKPNSRALNGFTPLHIACKKNHMRVMDLLLKQSASLEAVTESGLTPLHVASFMGHLN
IVKILLQKGASPSVSNVKVETPLHMASRAGHLEVAEFLLENSAPVDAKAKDDQTPLHCAA
RMGHKELVKLLLDHKANPNSTTTAGHTPLHIAAREGHVQTVRILLDMEAQQTKMTKKGFT
SLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSA
ARNGYTALHIASKQNQVEVANSLLQYGASANAESLQGVTPLHLASQEGRPDMVSLLISKQ
ANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVK
FLLQQQANVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGAQPNETTTHGMSALAIAKRLG
YISVIDVLKLVTEETVSMTTTEKHRMSFPETVDEILDVSEDEGEELLGTEGARYMKMDDM
KDHDDDFLSPKKSLENYSPAIPRIPRVSPENVNLPEHEMDQQHTPLPLPKEYDDDSLIPS
SPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCR
LVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVLRSE
NGSVWKEHRNRYGDEVLETILNGMDEELESQEELSKKRIRRIISTDFPLYFAVVSRVQQE
SDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVV
TVEPRRRKFHRPIGLRIPLPPSWRESPRDSGEGDTTSLRLLCSVIGGTAPAQWEDITGTT
KLLYASDCASFTTNVSARFWLADCPRTAEAVSFANLLYKELSAVPYMAKFVVFAKMNELR
EGRLRCYCMTDDKMDKTLEQHENFTEVARSRDIEVMEGMPLHLECSGNLVPVRKATQQPR
CFSFQAFRDNRLPVSVKVRDSSKEPTGFLSFLRKSTKYEDSQQVLCNLNITMPPCIKIIG
SEDRRRTLTPLALRERYSALNEPALASMSAMERTELKMAVIAEQLGLSWAELARELQLSV
DDINRIRVENPNSLLEQSSALLNLWATREGKRAKMESIYTALKNIDRMDIINMLEGHPPQ
PMRQGSRDLNRRRHNDKEHLSPGMTNGYGLAQEELHSPASMQYSLPSPLGAEPYWQEVSS
LDCAPIATTEEDTLMEMSDVQVWPSGNSPSLVPVEDSSLECSNADDSEASAGGVVLSGSI
ELPEDDSEMGVDSLSTTTPASIGGTIAGINLNGLNNGQGSEASSELSAVTSTTGGDGAEG
GGRRLGGTGSEEGHSLVSGQQRVYARLSESPGLSCVADRNGDRSANGGNGSGGGSFLSYL
QEQTGSGWMPVTDPTQAWVGTQSKPRGTQPFEKGLGFPHRVPELRAWDDVRLKGQQRGQF
EKSISDSIYIYTNVRQGDEVEDLAGGQVSEEQFTDEHGNIVTKKIVRKVVRRGKGLGEEG
VLEVEGSLLDANELEGDAEQYLSYAILGRDGSKTDSVDVKKGAQIVKCASLRRVKQ
Download sequence
Identical sequences M4ATX6
ENSXMAP00000017921 ENSXMAP00000017921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]