SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000018106 from Xiphophorus maculatus 76_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000018106
Domain Number 1 Region: 625-1039
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.77e-130
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000514
Further Details:      
 
Domain Number 2 Region: 24-290
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 3.02e-85
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000275
Further Details:      
 
Domain Number 3 Region: 292-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.28e-81
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000267
Further Details:      
 
Domain Number 4 Region: 1230-1401
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.24e-60
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000018106   Gene: ENSXMAG00000017992   Transcript: ENSXMAT00000018133
Sequence length 1701
Comment pep:known_by_projection scaffold:Xipmac4.4.2:JH556710.1:774901:784000:1 gene:ENSXMAG00000017992 transcript:ENSXMAT00000018133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVIVLALTVAFVASTQVNYAPEFAAGKTYEYKYEGYILGGLPEEGLARAGVKIQSKVLI
GAANPDNYILKLEDPVISEYSGIWPKEVFHPATKLTSALSAQLLTPIKFEYANGVIGKVY
APVGVSTTVLNIIRGILNIFQTNIKKTQNVYYLQETGVKGVCKTYYVLSEDPKADRLHLT
KTTDLNQCSEKINMNVGMAGYTDKCAECETRGEMFSGAMSLNYIMKPTASGSLILEATAT
ELLQYSPFNIVNGAVQMEAKQNITFVDVKKTPLEPIKADYVPRGSLKYELGTELLQTPIQ
LLRITNAEAQIVETLNNLVSLNLGKAHEDSPLKFIELIQLLRVARYESIEALWRQFKSKS
DHRHWMLSSIPAIGTHVALKFIKDKFVAGEVTAAEAAQAIMSSTHLVTADLESINLLEAL
AKTPKTQENAALREITMLGFGSMIHKYCAENPCTSELLRPIHDIITSALEKRDNDELSLA
LKVLGNVGHPSSLKPIMKLLPGFGSSASNLEHRVHVDAAMALRKIAKREPRMIQDVAIQL
FMDSALDQELRIIAAIVLFDTKLPLVMVTTVAQSLLNEPDLQVASFVYSYMKAFTRTTTP
DHSSVAAACNVAVRMLSPRLERLSYRYSRAFHYDHYYNPWMMGAAASAFYINDAATVLPR
NVMAKARVYLSGVYVDVLEFGARTEGVQEALLKVRDVPEDADRITKMKQALKALIEWRAN
PSRQPLGSLYVKVLGQEVAFANIDKEMVEKIIEFATGPEIRTYGKKALESLLSGYSVKYS
KPLLAIEVRHIFPSSLGLPMELSLYTAAVAAASVEVQATISPPPPENFHPVHLLRSDVSL
KASVAPSVSLHTYAVMGVNNPFIQATVMSRAKVHTVIPKKMEARLDIEKGYFNYQILPIE
GVKTIASARLETVAIARDVEDLAAAKVTPVVPLDNFSKKPILSLSQLLDSESNSEEFLPL
KRQSQSVRNMKIPKPIVKKMCAATYTFGIQACIDIRSRNAIFLKKTPIYAIIGNHTLMVN
VTPAAGPSIERIEIEVQIGEKAAEKILKAVILSEEDKILEDKNVLMKLKKILVPGLKNST
KSSSSSSSSSRSSSSSSRSSRSSSSSSRSSRSSSSSSSSSSSSSSSSSSSSSSSPKSSSS
SSSSSRKSKMLDLADPLNKTSKRSSSSSSSSSSSSSSSSSMSKQERYELNFTKDHIHQHS
ISAERLKSKSSASSFESIYNKAKYLSNTVRPQITVLVRAIRQDNKNQGYQFAAYYDRQTA
RVQIIVANLTENDNWTICTDSVMLSYHKVMTRLTWGAECKQFNTTVTVETGSVDKKPAIR
VKLAWTRLPHYMKKYSRRVSNWFYRVAEDIGVNRTKALNEPRQIKLTVAVVNETSLNVTL
KTPKEIQSNYYKLGWVTPLYLPMNNTAAEMQAYQGNWMEQVTYMLTKSNAAECAVVNDAV
VTFNNRKFKTEMPHSCPQVLAQDCTNELKFIVLLKRDQTAEQNEISIKIENIDVDMYLKD
KVVMVKVNGAEIPLNNLPYRHPSGRIHIKEKEEGISLFGPSHGLQEVFFSSDKVQVLVVD
WMRGQTCGICGKADGEVRQEYVTPNERVSRNATSFAHSWVLPAKSCREASGCFMQLESVK
LEKQVRVEGEESKCYSVEPVLRCLTGCQPVRTTSVTVGYHCVPMETNMNRSDGLSSIYEK
SIDVRETAESHLACRCTPQCA
Download sequence
Identical sequences M4AUG1
ENSXMAP00000018106 ENSXMAP00000018106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]