SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397679009|ref|YP_006520544.1| from Mycobacterium massiliense str. GO 06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397679009|ref|YP_006520544.1|
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.83e-78
Family ATP synthase (F1-ATPase), gamma subunit 0.0000403
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397679009|ref|YP_006520544.1|
Sequence length 308
Comment ATP synthase subunit gamma [Mycobacterium abscessus subsp. bolletii str. GO 06]
Sequence
MGAQIRELRRRIKSAGAIKKITKAQELIATSRIAKAQARVVAARPYATEITNVLTALADD
AALDHPLLVERPEPKRAGVLIVSSDRGLCGGYNANVLRVAEELYALLREQGKTPVVYVVG
RKALNYYNFRNRKVTEAWTGFSERPEYASAQKIAETLVEAFLAGADDEGDDPGLDGILGV
DELHIVYTEFKSMLTQAAVAKRIAPMEVEYVGEAAGPTTQYSFEPDATTLFGALLPRYLA
TRVYAALLEAAASESASRRRAMKAATDNADELIKGLTLEANGARQAQITQEISEIVGGVN
ALADAAGH
Download sequence
Identical sequences A0A0U0ZNC9 A0A1N4ZM72 A0A1N5S454 A0A1T7HFJ2
WP_005059849.1.100209 WP_005059849.1.100230 WP_005059849.1.10031 WP_005059849.1.100779 WP_005059849.1.101233 WP_005059849.1.101432 WP_005059849.1.101662 WP_005059849.1.10342 WP_005059849.1.10602 WP_005059849.1.10730 WP_005059849.1.11508 WP_005059849.1.11549 WP_005059849.1.11888 WP_005059849.1.12203 WP_005059849.1.125 WP_005059849.1.12593 WP_005059849.1.12695 WP_005059849.1.12850 WP_005059849.1.12971 WP_005059849.1.13439 WP_005059849.1.13518 WP_005059849.1.13703 WP_005059849.1.13789 WP_005059849.1.13890 WP_005059849.1.13978 WP_005059849.1.14802 WP_005059849.1.15031 WP_005059849.1.15084 WP_005059849.1.15406 WP_005059849.1.15682 WP_005059849.1.16250 WP_005059849.1.16469 WP_005059849.1.16491 WP_005059849.1.16991 WP_005059849.1.17 WP_005059849.1.17023 WP_005059849.1.17246 WP_005059849.1.17823 WP_005059849.1.18231 WP_005059849.1.18540 WP_005059849.1.18667 WP_005059849.1.18707 WP_005059849.1.18753 WP_005059849.1.18782 WP_005059849.1.18866 WP_005059849.1.19143 WP_005059849.1.19257 WP_005059849.1.19356 WP_005059849.1.19500 WP_005059849.1.19688 WP_005059849.1.19799 WP_005059849.1.19932 WP_005059849.1.20033 WP_005059849.1.20137 WP_005059849.1.20410 WP_005059849.1.20903 WP_005059849.1.21239 WP_005059849.1.21287 WP_005059849.1.22055 WP_005059849.1.22116 WP_005059849.1.2268 WP_005059849.1.22795 WP_005059849.1.22807 WP_005059849.1.23296 WP_005059849.1.2360 WP_005059849.1.23874 WP_005059849.1.23947 WP_005059849.1.2412 WP_005059849.1.2448 WP_005059849.1.24564 WP_005059849.1.24614 WP_005059849.1.24821 WP_005059849.1.24932 WP_005059849.1.24973 WP_005059849.1.2523 WP_005059849.1.25468 WP_005059849.1.25535 WP_005059849.1.25586 WP_005059849.1.25653 WP_005059849.1.25672 WP_005059849.1.25762 WP_005059849.1.25778 WP_005059849.1.25900 WP_005059849.1.26069 WP_005059849.1.26155 WP_005059849.1.2646 WP_005059849.1.26684 WP_005059849.1.26996 WP_005059849.1.27031 WP_005059849.1.27784 WP_005059849.1.27895 WP_005059849.1.28163 WP_005059849.1.28286 WP_005059849.1.2898 WP_005059849.1.30071 WP_005059849.1.30293 WP_005059849.1.30449 WP_005059849.1.3048 WP_005059849.1.30577 WP_005059849.1.31118 WP_005059849.1.31258 WP_005059849.1.31415 WP_005059849.1.31687 WP_005059849.1.32011 WP_005059849.1.32026 WP_005059849.1.32241 WP_005059849.1.32766 WP_005059849.1.32855 WP_005059849.1.33411 WP_005059849.1.33548 WP_005059849.1.33568 WP_005059849.1.33619 WP_005059849.1.33672 WP_005059849.1.33721 WP_005059849.1.33928 WP_005059849.1.34087 WP_005059849.1.34095 WP_005059849.1.34432 WP_005059849.1.34518 WP_005059849.1.3466 WP_005059849.1.34725 WP_005059849.1.34939 WP_005059849.1.35041 WP_005059849.1.35163 WP_005059849.1.35808 WP_005059849.1.3587 WP_005059849.1.36043 WP_005059849.1.36296 WP_005059849.1.3631 WP_005059849.1.36346 WP_005059849.1.36452 WP_005059849.1.36464 WP_005059849.1.36625 WP_005059849.1.36650 WP_005059849.1.36744 WP_005059849.1.36855 WP_005059849.1.36924 WP_005059849.1.37017 WP_005059849.1.37349 WP_005059849.1.3736 WP_005059849.1.37402 WP_005059849.1.37604 WP_005059849.1.37670 WP_005059849.1.37768 WP_005059849.1.37785 WP_005059849.1.37928 WP_005059849.1.38298 WP_005059849.1.38954 WP_005059849.1.3911 WP_005059849.1.39187 WP_005059849.1.3946 WP_005059849.1.39574 WP_005059849.1.39612 WP_005059849.1.39628 WP_005059849.1.3969 WP_005059849.1.39744 WP_005059849.1.39885 WP_005059849.1.40222 WP_005059849.1.40477 WP_005059849.1.41056 WP_005059849.1.41067 WP_005059849.1.41081 WP_005059849.1.41485 WP_005059849.1.41595 WP_005059849.1.41691 WP_005059849.1.42039 WP_005059849.1.42157 WP_005059849.1.42175 WP_005059849.1.42186 WP_005059849.1.42875 WP_005059849.1.42895 WP_005059849.1.42915 WP_005059849.1.43004 WP_005059849.1.43117 WP_005059849.1.43171 WP_005059849.1.43178 WP_005059849.1.43355 WP_005059849.1.43365 WP_005059849.1.43397 WP_005059849.1.43629 WP_005059849.1.43631 WP_005059849.1.44442 WP_005059849.1.45085 WP_005059849.1.45194 WP_005059849.1.45677 WP_005059849.1.45824 WP_005059849.1.46142 WP_005059849.1.46265 WP_005059849.1.46390 WP_005059849.1.46641 WP_005059849.1.46844 WP_005059849.1.46960 WP_005059849.1.47229 WP_005059849.1.47271 WP_005059849.1.47324 WP_005059849.1.47367 WP_005059849.1.47418 WP_005059849.1.47491 WP_005059849.1.47601 WP_005059849.1.47713 WP_005059849.1.47721 WP_005059849.1.47757 WP_005059849.1.47915 WP_005059849.1.4793 WP_005059849.1.48032 WP_005059849.1.48079 WP_005059849.1.48159 WP_005059849.1.4828 WP_005059849.1.48302 WP_005059849.1.48458 WP_005059849.1.48640 WP_005059849.1.4874 WP_005059849.1.48895 WP_005059849.1.48914 WP_005059849.1.4893 WP_005059849.1.49292 WP_005059849.1.4954 WP_005059849.1.498 WP_005059849.1.50402 WP_005059849.1.50620 WP_005059849.1.50855 WP_005059849.1.50909 WP_005059849.1.50916 WP_005059849.1.51595 WP_005059849.1.51604 WP_005059849.1.51759 WP_005059849.1.52476 WP_005059849.1.5254 WP_005059849.1.52636 WP_005059849.1.5267 WP_005059849.1.528 WP_005059849.1.53120 WP_005059849.1.53358 WP_005059849.1.53468 WP_005059849.1.53765 WP_005059849.1.53876 WP_005059849.1.54149 WP_005059849.1.54326 WP_005059849.1.55036 WP_005059849.1.55601 WP_005059849.1.55939 WP_005059849.1.56143 WP_005059849.1.56609 WP_005059849.1.56672 WP_005059849.1.56891 WP_005059849.1.56935 WP_005059849.1.56938 WP_005059849.1.57172 WP_005059849.1.57258 WP_005059849.1.57285 WP_005059849.1.5792 WP_005059849.1.57967 WP_005059849.1.58256 WP_005059849.1.58716 WP_005059849.1.5902 WP_005059849.1.59050 WP_005059849.1.59544 WP_005059849.1.59703 WP_005059849.1.59946 WP_005059849.1.59947 WP_005059849.1.60260 WP_005059849.1.60273 WP_005059849.1.60354 WP_005059849.1.60456 WP_005059849.1.60553 WP_005059849.1.61063 WP_005059849.1.61125 WP_005059849.1.61744 WP_005059849.1.62472 WP_005059849.1.62556 WP_005059849.1.62588 WP_005059849.1.62827 WP_005059849.1.63790 WP_005059849.1.63861 WP_005059849.1.63965 WP_005059849.1.64635 WP_005059849.1.65216 WP_005059849.1.65615 WP_005059849.1.65825 WP_005059849.1.66000 WP_005059849.1.6607 WP_005059849.1.66750 WP_005059849.1.66780 WP_005059849.1.66859 WP_005059849.1.67082 WP_005059849.1.67337 WP_005059849.1.67485 WP_005059849.1.6751 WP_005059849.1.67981 WP_005059849.1.68014 WP_005059849.1.68035 WP_005059849.1.68198 WP_005059849.1.68419 WP_005059849.1.68968 WP_005059849.1.69075 WP_005059849.1.69092 WP_005059849.1.69853 WP_005059849.1.69956 WP_005059849.1.70111 WP_005059849.1.70212 WP_005059849.1.70479 WP_005059849.1.70925 WP_005059849.1.71152 WP_005059849.1.71190 WP_005059849.1.71374 WP_005059849.1.71775 WP_005059849.1.71784 WP_005059849.1.72320 WP_005059849.1.72851 WP_005059849.1.73131 WP_005059849.1.73361 WP_005059849.1.73632 WP_005059849.1.73670 WP_005059849.1.73788 WP_005059849.1.74063 WP_005059849.1.7414 WP_005059849.1.74336 WP_005059849.1.74413 WP_005059849.1.74493 WP_005059849.1.74505 WP_005059849.1.74662 WP_005059849.1.74714 WP_005059849.1.75255 WP_005059849.1.75425 WP_005059849.1.75495 WP_005059849.1.76048 WP_005059849.1.76084 WP_005059849.1.76353 WP_005059849.1.76389 WP_005059849.1.76789 WP_005059849.1.76842 WP_005059849.1.76870 WP_005059849.1.76949 WP_005059849.1.77270 WP_005059849.1.77339 WP_005059849.1.77461 WP_005059849.1.77985 WP_005059849.1.78055 WP_005059849.1.78213 WP_005059849.1.78391 WP_005059849.1.78442 WP_005059849.1.78665 WP_005059849.1.7922 WP_005059849.1.79843 WP_005059849.1.80323 WP_005059849.1.80912 WP_005059849.1.81053 WP_005059849.1.81450 WP_005059849.1.81953 WP_005059849.1.820 WP_005059849.1.82204 WP_005059849.1.8231 WP_005059849.1.82457 WP_005059849.1.82849 WP_005059849.1.82852 WP_005059849.1.82965 WP_005059849.1.83310 WP_005059849.1.83488 WP_005059849.1.83521 WP_005059849.1.83610 WP_005059849.1.84018 WP_005059849.1.84094 WP_005059849.1.84206 WP_005059849.1.84239 WP_005059849.1.84296 WP_005059849.1.84400 WP_005059849.1.84574 WP_005059849.1.84788 WP_005059849.1.84798 WP_005059849.1.84810 WP_005059849.1.85006 WP_005059849.1.85046 WP_005059849.1.85626 WP_005059849.1.85664 WP_005059849.1.8604 WP_005059849.1.8611 WP_005059849.1.86417 WP_005059849.1.86491 WP_005059849.1.86521 WP_005059849.1.86854 WP_005059849.1.86938 WP_005059849.1.87124 WP_005059849.1.87128 WP_005059849.1.87181 WP_005059849.1.87518 WP_005059849.1.87569 WP_005059849.1.87785 WP_005059849.1.87814 WP_005059849.1.88010 WP_005059849.1.88100 WP_005059849.1.88188 WP_005059849.1.88721 WP_005059849.1.88813 WP_005059849.1.88868 WP_005059849.1.89005 WP_005059849.1.89104 WP_005059849.1.89233 WP_005059849.1.8948 WP_005059849.1.89581 WP_005059849.1.9000 WP_005059849.1.90753 WP_005059849.1.91136 WP_005059849.1.9116 WP_005059849.1.91517 WP_005059849.1.91677 WP_005059849.1.91727 WP_005059849.1.91945 WP_005059849.1.9201 WP_005059849.1.92064 WP_005059849.1.92366 WP_005059849.1.92514 WP_005059849.1.92709 WP_005059849.1.92927 WP_005059849.1.93120 WP_005059849.1.93433 WP_005059849.1.93551 WP_005059849.1.9425 WP_005059849.1.94472 WP_005059849.1.94485 WP_005059849.1.94627 WP_005059849.1.94706 WP_005059849.1.94757 WP_005059849.1.94937 WP_005059849.1.9507 WP_005059849.1.95572 WP_005059849.1.95766 WP_005059849.1.96023 WP_005059849.1.96064 WP_005059849.1.96196 WP_005059849.1.96459 WP_005059849.1.96599 WP_005059849.1.96630 WP_005059849.1.97105 WP_005059849.1.97183 WP_005059849.1.97572 WP_005059849.1.97909 WP_005059849.1.98269 WP_005059849.1.9871 WP_005059849.1.98878 WP_005059849.1.99112 WP_005059849.1.99141 WP_005059849.1.99441 WP_005059849.1.99679 WP_005059849.1.99848 WP_005059849.1.99911 WP_005059849.1.99957 gi|397679009|ref|YP_006520544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]