SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397679581|ref|YP_006521116.1| from Mycobacterium massiliense str. GO 06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397679581|ref|YP_006521116.1|
Domain Number 1 Region: 4-512
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 3.93e-211
Family Heme-dependent catalases 0.0000000000178
Further Details:      
 
Domain Number 2 Region: 536-695
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 3.37e-21
Family Catalase, C-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397679581|ref|YP_006521116.1|
Sequence length 702
Comment catalase HPII [Mycobacterium abscessus subsp. bolletii str. GO 06]
Sequence
MDHTSNPKQEQLDTSRVDRASGYLTTQQGVRVDHTDDALTAGVRGPTLLEDFHAREKVTH
FDHERIPERVVHARGAGAYGYFEPYDAWLSDFTAAKFLTTPGLRTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTQQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPDNEIPQAASA
HDTLWDFVAEQPETLHAIMWLMSDRALPRSYRMMQGFGVHTFRLVNDAGEGVFVKFHWKP
LLGVHSLLWDECQQIAGKDPDFNRRDLWDAIESGQFPEWELGVQLVPESDEFKFPFDLLD
ATKIIPEEQVPVQPVGRMVLDRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPIAEVHNNQQDGFAQHDIPQGKSSYFKNTLGGGCPALAHE
DVFRHYTQRVDGHKIRQRAESFKDFYSQARMFWKSMSAIEAQHIVSAFSFELGKVSAESG
IRERVVVQLNLVEHDLASQVALQLGLPAPAPQSADEALPPSPALSQLSSTRDSVATRRIA
VLAADGVDIHGVDLLRTALEESDAIVEILAPTGGGTLTGESGGELRVDRAMTTMASVLYD
AVVVPSGAESAWRLARNGFAVHFVSEAYKHLKPVAAYGAGLDLLRAASVVETLATTAEIV
VDDGVVTTTAEASALPAEFVAAFVTAISRHRAWERETEMVPA
Download sequence
Identical sequences A0A0U1AYU7 A0A1U3DB65 X8DSS5
gi|397679581|ref|YP_006521116.1| WP_005058227.1.100209 WP_005058227.1.100230 WP_005058227.1.10031 WP_005058227.1.100779 WP_005058227.1.101432 WP_005058227.1.101662 WP_005058227.1.10342 WP_005058227.1.10602 WP_005058227.1.10730 WP_005058227.1.11508 WP_005058227.1.11549 WP_005058227.1.11888 WP_005058227.1.12203 WP_005058227.1.125 WP_005058227.1.12593 WP_005058227.1.12695 WP_005058227.1.12850 WP_005058227.1.13439 WP_005058227.1.13518 WP_005058227.1.13789 WP_005058227.1.13890 WP_005058227.1.13978 WP_005058227.1.14802 WP_005058227.1.15031 WP_005058227.1.15084 WP_005058227.1.15406 WP_005058227.1.16250 WP_005058227.1.16991 WP_005058227.1.17023 WP_005058227.1.17246 WP_005058227.1.17823 WP_005058227.1.18231 WP_005058227.1.18782 WP_005058227.1.19257 WP_005058227.1.19356 WP_005058227.1.19500 WP_005058227.1.19688 WP_005058227.1.19799 WP_005058227.1.19932 WP_005058227.1.20137 WP_005058227.1.20410 WP_005058227.1.20903 WP_005058227.1.22116 WP_005058227.1.2226 WP_005058227.1.2268 WP_005058227.1.22795 WP_005058227.1.22807 WP_005058227.1.23296 WP_005058227.1.2360 WP_005058227.1.23947 WP_005058227.1.2412 WP_005058227.1.2448 WP_005058227.1.24564 WP_005058227.1.24973 WP_005058227.1.25468 WP_005058227.1.25535 WP_005058227.1.25586 WP_005058227.1.25778 WP_005058227.1.25900 WP_005058227.1.26155 WP_005058227.1.2646 WP_005058227.1.26996 WP_005058227.1.27031 WP_005058227.1.27784 WP_005058227.1.28286 WP_005058227.1.28344 WP_005058227.1.28438 WP_005058227.1.2898 WP_005058227.1.30071 WP_005058227.1.30293 WP_005058227.1.30449 WP_005058227.1.3048 WP_005058227.1.30577 WP_005058227.1.31118 WP_005058227.1.31258 WP_005058227.1.31415 WP_005058227.1.32011 WP_005058227.1.32026 WP_005058227.1.32766 WP_005058227.1.33411 WP_005058227.1.33548 WP_005058227.1.33672 WP_005058227.1.33721 WP_005058227.1.33928 WP_005058227.1.34087 WP_005058227.1.34095 WP_005058227.1.34432 WP_005058227.1.34518 WP_005058227.1.3466 WP_005058227.1.34725 WP_005058227.1.34939 WP_005058227.1.34988 WP_005058227.1.35041 WP_005058227.1.35163 WP_005058227.1.35808 WP_005058227.1.3587 WP_005058227.1.36346 WP_005058227.1.36452 WP_005058227.1.36464 WP_005058227.1.36650 WP_005058227.1.36855 WP_005058227.1.36924 WP_005058227.1.37017 WP_005058227.1.37349 WP_005058227.1.3736 WP_005058227.1.37402 WP_005058227.1.37604 WP_005058227.1.37768 WP_005058227.1.37785 WP_005058227.1.37928 WP_005058227.1.38298 WP_005058227.1.38954 WP_005058227.1.39187 WP_005058227.1.39574 WP_005058227.1.39612 WP_005058227.1.39628 WP_005058227.1.39744 WP_005058227.1.39885 WP_005058227.1.40222 WP_005058227.1.40477 WP_005058227.1.41056 WP_005058227.1.41595 WP_005058227.1.41691 WP_005058227.1.42039 WP_005058227.1.42157 WP_005058227.1.42175 WP_005058227.1.42186 WP_005058227.1.42296 WP_005058227.1.42875 WP_005058227.1.42895 WP_005058227.1.43004 WP_005058227.1.43117 WP_005058227.1.43171 WP_005058227.1.43178 WP_005058227.1.43355 WP_005058227.1.43365 WP_005058227.1.43397 WP_005058227.1.43629 WP_005058227.1.43631 WP_005058227.1.44442 WP_005058227.1.45085 WP_005058227.1.45194 WP_005058227.1.45677 WP_005058227.1.45824 WP_005058227.1.46142 WP_005058227.1.46265 WP_005058227.1.46390 WP_005058227.1.46844 WP_005058227.1.46960 WP_005058227.1.47229 WP_005058227.1.47271 WP_005058227.1.47324 WP_005058227.1.47367 WP_005058227.1.47491 WP_005058227.1.47601 WP_005058227.1.47721 WP_005058227.1.47757 WP_005058227.1.47915 WP_005058227.1.48079 WP_005058227.1.48159 WP_005058227.1.4828 WP_005058227.1.48302 WP_005058227.1.48458 WP_005058227.1.48895 WP_005058227.1.48914 WP_005058227.1.4893 WP_005058227.1.49292 WP_005058227.1.4954 WP_005058227.1.50203 WP_005058227.1.50402 WP_005058227.1.50620 WP_005058227.1.50855 WP_005058227.1.50909 WP_005058227.1.51442 WP_005058227.1.51595 WP_005058227.1.5254 WP_005058227.1.5267 WP_005058227.1.528 WP_005058227.1.53120 WP_005058227.1.53358 WP_005058227.1.53765 WP_005058227.1.54149 WP_005058227.1.54172 WP_005058227.1.54308 WP_005058227.1.54326 WP_005058227.1.55601 WP_005058227.1.56143 WP_005058227.1.56401 WP_005058227.1.56609 WP_005058227.1.56672 WP_005058227.1.56891 WP_005058227.1.56938 WP_005058227.1.57172 WP_005058227.1.57285 WP_005058227.1.5792 WP_005058227.1.57967 WP_005058227.1.58256 WP_005058227.1.58716 WP_005058227.1.5902 WP_005058227.1.59544 WP_005058227.1.59703 WP_005058227.1.59946 WP_005058227.1.59947 WP_005058227.1.60260 WP_005058227.1.60273 WP_005058227.1.60354 WP_005058227.1.60456 WP_005058227.1.60553 WP_005058227.1.61063 WP_005058227.1.61125 WP_005058227.1.61461 WP_005058227.1.61744 WP_005058227.1.62472 WP_005058227.1.62556 WP_005058227.1.62588 WP_005058227.1.62827 WP_005058227.1.63790 WP_005058227.1.63965 WP_005058227.1.64466 WP_005058227.1.64600 WP_005058227.1.65216 WP_005058227.1.65615 WP_005058227.1.65825 WP_005058227.1.66000 WP_005058227.1.6607 WP_005058227.1.66750 WP_005058227.1.66859 WP_005058227.1.67082 WP_005058227.1.67337 WP_005058227.1.67981 WP_005058227.1.68014 WP_005058227.1.68035 WP_005058227.1.68419 WP_005058227.1.68968 WP_005058227.1.69075 WP_005058227.1.69092 WP_005058227.1.69956 WP_005058227.1.7004 WP_005058227.1.70212 WP_005058227.1.70479 WP_005058227.1.70612 WP_005058227.1.70925 WP_005058227.1.71152 WP_005058227.1.71190 WP_005058227.1.71374 WP_005058227.1.71775 WP_005058227.1.72320 WP_005058227.1.72851 WP_005058227.1.73361 WP_005058227.1.73632 WP_005058227.1.74063 WP_005058227.1.7414 WP_005058227.1.74336 WP_005058227.1.74413 WP_005058227.1.74493 WP_005058227.1.74505 WP_005058227.1.74662 WP_005058227.1.75255 WP_005058227.1.75425 WP_005058227.1.75495 WP_005058227.1.76389 WP_005058227.1.76789 WP_005058227.1.76842 WP_005058227.1.76870 WP_005058227.1.76949 WP_005058227.1.77270 WP_005058227.1.77985 WP_005058227.1.78055 WP_005058227.1.78213 WP_005058227.1.78391 WP_005058227.1.78665 WP_005058227.1.7922 WP_005058227.1.79843 WP_005058227.1.80323 WP_005058227.1.80912 WP_005058227.1.81953 WP_005058227.1.820 WP_005058227.1.82204 WP_005058227.1.8231 WP_005058227.1.82849 WP_005058227.1.82852 WP_005058227.1.82965 WP_005058227.1.83310 WP_005058227.1.84018 WP_005058227.1.84094 WP_005058227.1.84206 WP_005058227.1.84239 WP_005058227.1.84296 WP_005058227.1.84400 WP_005058227.1.84788 WP_005058227.1.84798 WP_005058227.1.84810 WP_005058227.1.85006 WP_005058227.1.85046 WP_005058227.1.8604 WP_005058227.1.8611 WP_005058227.1.86491 WP_005058227.1.86521 WP_005058227.1.86938 WP_005058227.1.87103 WP_005058227.1.87518 WP_005058227.1.87569 WP_005058227.1.88010 WP_005058227.1.88721 WP_005058227.1.89005 WP_005058227.1.89104 WP_005058227.1.8948 WP_005058227.1.89501 WP_005058227.1.89581 WP_005058227.1.9000 WP_005058227.1.91136 WP_005058227.1.9116 WP_005058227.1.91517 WP_005058227.1.91727 WP_005058227.1.91945 WP_005058227.1.9201 WP_005058227.1.92064 WP_005058227.1.92366 WP_005058227.1.92514 WP_005058227.1.92709 WP_005058227.1.92927 WP_005058227.1.93433 WP_005058227.1.93551 WP_005058227.1.9425 WP_005058227.1.94472 WP_005058227.1.94485 WP_005058227.1.94627 WP_005058227.1.94706 WP_005058227.1.94757 WP_005058227.1.9507 WP_005058227.1.95572 WP_005058227.1.96196 WP_005058227.1.96459 WP_005058227.1.96599 WP_005058227.1.96630 WP_005058227.1.97105 WP_005058227.1.97183 WP_005058227.1.97572 WP_005058227.1.97909 WP_005058227.1.98269 WP_005058227.1.9871 WP_005058227.1.98878 WP_005058227.1.99112 WP_005058227.1.99141 WP_005058227.1.99848 WP_005058227.1.99957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]