SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397680370|ref|YP_006521905.1| from Mycobacterium massiliense str. GO 06

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397680370|ref|YP_006521905.1|
Domain Number 1 Region: 50-363
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 4.71e-46
Family Heme-dependent catalases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397680370|ref|YP_006521905.1|
Sequence length 377
Comment hypothetical protein MYCMA_2169 [Mycobacterium abscessus subsp. bolletii str. GO 06]
Sequence
MTAMSESGELLDAQRSYLRYRDDMAVAPPGEEEVIDRIIRVLHKNNERAYQKYRHGVRDA
HAKSHAVLRGELTVYPDLEPELRQGMFATPGTYPVVVRLSSTSGALRSDKVRGVRGLGIK
VLGVDGPRTLPDDDATTQDFVMVTHREFLFADAREYLRKGMPTAWLIARLSDTALAGGAR
VLGAIAKCLSRIGISIPETVTVFVRPNVHILGDTFYSSAPLRFGDYVAKLQYVPLSPSVA
ELKDKPLSDDVDDDVFRHMIAEFFRTHSAEYELQAQLCTDVKKMPLEDATVAWPEELSPH
RPIAKITFPVQDSYSAQRRAYGDDVLSYNSWRALEAHRPLGSINRLKLRVYEASSNFRHD
KNMVPRVEPARAEEIPD
Download sequence
Identical sequences gi|397680370|ref|YP_006521905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]