SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012079 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012079
Domain Number 1 Region: 46-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-32
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 2 Region: 176-300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-20
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 3 Region: 299-335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012079   Gene: ENSXMAG00000012052   Transcript: ENSXMAT00000012095
Sequence length 545
Comment pep:novel scaffold:Xipmac4.4.2:JH556739.1:944088:963083:-1 gene:ENSXMAG00000012052 transcript:ENSXMAT00000012095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYLSQLCRLLNITWILFFLIEEGFALAQRTKDSPGDPGGQSPGQNDCGTWVRNINGGVFM
SPNYPNTYPPNKECVYILEALPRQRIQLAFDKNYYIEPSFQCRFDHIEIRDGPFGFSPII
DRFCGGKNPGLVTSTGRFMWIKFTSDEELEGLGFRIQYTFVADPDFHLHVGGLLNPIPDC
QFEIGGWDGIIRSSQVEEEERVKPGDALDCIWTIRAPPQSKIYLRFMDYQMEHSNECKKN
FVAVYDGSSAIENLKAKFCSTVANDLMLDNGVGVIRMWADEKSRLSRFRMLFTSYIDPPC
TANTFFCHSNMCINNTLVCNGIQNCVYPWDENHCKEKRSKGLFHQITKTHGTVIGVSSGI
VLVLLIISILVQMKQPRKKVVARRPGVFNKAGFQEVFDPPHYELFSLRDKEMSSDLGDLS
EELDSFHKVRRSSTMSRCVHEHHCGSQGSVATGGGGGGGGSMKHSRTTLSSMELSYHNDF
SKPPPMKTFNSTSTYKKSCYGYKQHSQTHDCDQQVIEDRVTEEIPCEIYGRGAVDPQQRS
ISMDF
Download sequence
Identical sequences M4AC85
ENSXMAP00000012079 ENSXMAP00000012079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]