SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000015220 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000015220
Domain Number 1 Region: 111-180
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.53e-25
Family GAS2 domain 0.0000517
Further Details:      
 
Domain Number 2 Region: 4-87
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.19e-17
Family Calponin-homology domain, CH-domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000015220   Gene: ENSXMAG00000015196   Transcript: ENSXMAT00000015241
Sequence length 180
Comment pep:novel scaffold:Xipmac4.4.2:AGAJ01043779.1:788:8124:1 gene:ENSXMAG00000015196 transcript:ENSXMAT00000015241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVRRVIHWRADATSGSFFARDNTANFLYWCRKIGVDEAYLFESEDLVLHKQPWEVCLCLM
ELGRIAARYGVEPPGLVKLEKEIEREEAGCLSPSSPLCFKSRSRRSVSTSILDDIVRSII
ENPPCSCPTRFPVEKQPKGCYRVGDKVLYLRMLNERHVMVRVGGGWDTFIGYLQKHDPCR
Download sequence
Identical sequences M4AL76
ENSXMAP00000015220 ENSXMAP00000015220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]