SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|161611932|gb|AAI55719| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|161611932|gb|AAI55719|
Domain Number 1 Region: 1379-1567
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 5.23e-42
Family Transcriptional factor tubby, C-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 12-224,290-361
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.87e-26
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 566-674
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.00000000000000128
Family Transcriptional factor tubby, C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  gi|161611932|gb|AAI55719|
Domain Number - Region: 372-478
Classification Level Classification E-value
Superfamily TNF-like 0.0082
Family TNF-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|161611932|gb|AAI55719|
Sequence length 1568
Comment tulp4 protein [Xenopus (Silurana) tropicalis]
Sequence
MYASVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFT
LSHCRRDRNTPQRTNFNLRGHNSEVVLVRWNEPFQKLATCDADGGIFVWIQYEGRWSVEL
VNDRGAQVSDFTWSHDGTQALISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQ
QVLFGTADGQVIVMDCHGRMLAHVLLHESDGIVNMSWNYPSFLVEDSSESDTDSDDYSPP
QDGPAAYPIPVENIKPLLTVGFTSGDIRLMNNYDDLSPTIVRSGLKDVVVQWCTQGDLLA
VAGMEKQNLIPEHVNGNSLKSALIKFYNVRGEHIYTLETPVQRPITSICWGHRDSRLFLA
SGPALYVVRVEHRVASLQLLCQQTIATSLSDDKDICKLNLPPRLCSYLTTAFIPTIKPPI
PDPNNMRDFVSYPTSGNERLHCTMKRTEDDPEVGGPCYTLYLEYLGGLVPVLKGRRISKL
RPEFVIMDPKTDAKTDEIYGNGLISSVIDSCNCSDSSDIELSDDWAAKKSPKISRASKSP
KLPRINIEARKSPKLPRAAQEITRSPRLPIRKPSIGSPSLTRRECPLEDITQHNYLAQVT
SNIWGTKFKIVGLAAFLPANLGAVIYKTSLLHLQPRQMTIYLPEVRKISMDYINLPVFNT
NVFSEDEDDLPVTGTSGAPENNPPCTVNIPIAPIHSSAQAMSPTQSIGLVQSLLANQNVQ
LDVLANQMVAAAPPLDHPTESAVPYPAPNRYANPGQVIFGGVEMGRLIQPPQPPMQMAHP
PQGSAQMSIIDHSERDHEHLQKTKPLRTIPQYAEGDAVVFTAVQEIQNHKLNPPPPYPGT
IPAPPTSAAPPPPISQPPVDLCSKKSEFSLFANPHYQPPLGYERITTFDSSGNVEEVCRP
RMRMLCTQNTYTLQGPGSSATLRVSATEKKIKQPCTSATLNRLTVPRYSIPSGDPPPYPE
IAAQLAQGRNMAQRIDSSLIHATLRRNSREAALKMAQIVDNQRAPQQHPPKSKSNVVPAQ
FQQRTPTALYTCSQCSSGTGVMSSSNHTGNISTSTIGVGSIRPDLSTGSGPQQSTVIVHS
ASTTPLASQSSYNLLSPAESSRDRTDYINSAFTEDEAVSQHCSVEKPVRHLSLAEAGLTI
KRPPPYQWDPRVSEDIWVPQERTAHNTLPIPKRPPPLIIGQNQHLDMSRVPFISPKSPTS
PISTFQANYGVGIPYTGAYSVPLPHQQIPNPCSPKEALSPPQFVQQEPTIVIQPAYPPNL
PCCPLPPMYPGNSTCNGLQLPAIALHPWNSYNACPPVQSVQAALPPKPHVVPEKTVLSPP
HPELQSNIGTEVMVETADNFQEVLSLTESPVPQRTDKFAKKNRKRIDSRAEEGNVQAITE
GKVKKDARTLGDFNSLIASPRLGREKKKVKSQKDQLKSKKLNKTNEFQDSSESEPELFIS
GDELMNQSQSNKKGWKTKRNLRTASDLDEFKCRKANEKDDGRLGSQGFVYVMANKQPLWN
EATQVYQLDFGGRVTQESAKNFQIELEGRQVMQFGRIDGNAYILDFQYPFSAVQAFAVAL
ANVTQRLK
Download sequence
Identical sequences A9JRM4
NP_001107316.1.99540 gi|161611932|gb|AAI55719| gi|166158280|ref|NP_001107316|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]