SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|183986727|ref|NP_001116953| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|183986727|ref|NP_001116953|
Domain Number 1 Region: 251-509
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 6.28e-110
Family Transcriptional factor tubby, C-terminal domain 0.00000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|183986727|ref|NP_001116953|
Sequence length 509
Comment tubby like protein 3 [Xenopus (Silurana) tropicalis]
Sequence
MERTGERSGGTSMFEDESARLRHLKLENQRTLLEQKQRKKRQEILMVQSNRDTRQRRPKS
GKCEEQAPLVQSQKQKSVNCNVILNGIDGPAAFLDSGFHELDSKIQVLTVGESCTDTDFN
VGTGWPSCNEGRASPCNSERRGTPVSDEENTQPLNSIGRSNLEKTQQNSNRQEILRKPDV
SKRDLQELLQERGISDSLNFDEDISDDDDGDDDDEACNASTRPASASSKKSLTETGTAEA
VPPDPSGDIGEIGDLKEFALRPAPRGVVIKTRISRDKKGMDRGLYPTYYMHLERDNNRKV
FLLAGRKRKRSKTSNYLISIDPTDLSREGGNFIGKLRSNLMGTKFTIYDNGESPAKVQGH
MSNPTTRQEMAAVCYETNVLGFKGPRKMTVLIPGMNLNHERIPFQPQNDSESLLSRWGNK
CQENIIELHNKAPVWNDDTQSYVLNFHGRVTHASVKNFQIVHDNDPDYIVMQFGRVAEDF
FTLDYSYPLCALQAFSVALSSFDSKLACE
Download sequence
Identical sequences B1H1K3
gi|169641956|gb|AAI60638| gi|183986727|ref|NP_001116953| NP_001116953.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]