SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301615870|gb|XP_002937394| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|301615870|gb|XP_002937394|
Domain Number - Region: 252-330
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0162
Family At5g01750-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301615870|gb|XP_002937394|
Sequence length 338
Comment PREDICTED: hypothetical protein LOC100497953 [Xenopus (Silurana) tropicalis]
Sequence
metaldtggrnwermqlsslshsdseddlqkffvsaalielkflywikypprkrqlivpc
imsaidtqptlfgylkrekhiepfsgiskvdkkvcrcfktmhtqqalqqmddltnpnrak
snntmkvlryskgvrsvgkacnqedpisscsvtsipgsrnmdnhrplpvveeldesasae
lqilsgaqqfcitskskpqdssclclhlcgparscslrlcdyskeevlrfcrpyrvdmcc
lfcclmvisvfsssgnligsvqqrwslfspslavydaygrkimeikgswsatrchtdqef
qvtsldgqllaviwkrwpgfnmdynmdhdffginskkv
Download sequence
Identical sequences gi|301615870|gb|XP_002937394|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]