SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301618301|gb|XP_002938566| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301618301|gb|XP_002938566|
Domain Number 1 Region: 287-546
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 2.88e-108
Family Transcriptional factor tubby, C-terminal domain 0.00000000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301618301|gb|XP_002938566|
Sequence length 546
Comment PREDICTED: tubby protein homolog [Xenopus (Silurana) tropicalis]
Sequence
megdmnvrqqklnhqrnlfqekqrrkreeplmfqanpdvkgkprrtrktedqaplvdscs
issiymgannpsmseehsgssptglkaepdsntsnadeqdyscedieetiledtkplnnk
ghlvtarrrqktkaktgkwdlkesktkaqtascksskksksppakdaekentpqekgfdd
vaafhdelqemhtntsfpvqhsseegessftvgdrkippapvkrrnkkkttkpghsrtkc
hsskervaqateeddfdgesdilssvvytrpvstssreedthlaaaietddlegfalrpa
pnnmifqcritrdkkgvdkgiyptyylhlerddgkrlflmagrkrkkcktsnylisvdpt
dlsrdgdsfigkvrsnmlgtkftvfdngvnpdtkpfvqereslrqelvsicyetnvlgfr
gprkmtviipsmnmegervsirprnehetllsrfqtgnmeniialqnkapswneetqsfv
lnfhgrvtqasvknfqiispedpeyiimqfgrvaedvftmdfqyplcalqafsiclssfd
sklace
Download sequence
Identical sequences gi|301618301|gb|XP_002938566|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]