SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301631137|gb|XP_002944663| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301631137|gb|XP_002944663|
Domain Number 1 Region: 1-72
Classification Level Classification E-value
Superfamily Homeodomain-like 2.98e-19
Family Tetracyclin repressor-like, N-terminal domain 0.0053
Further Details:      
 
Domain Number 2 Region: 85-205
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000000000228
Family Tetracyclin repressor-like, C-terminal domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301631137|gb|XP_002944663|
Sequence length 211
Comment PREDICTED: HTH-type transcriptional regulator ttgR-like [Xenopus (Silurana) tropicalis]
Sequence
mmvrrtkkdaaatrnslldaaervfydkgvsraslgdiaqaagatrgaiywhfkdkadlf
nammdrvtpplehayglgsvgaeegtslrrlrgalqgvlhavatdeqarrvfeiamykve
yvqelvavrdryvmecanvraklredmasaakaqaltltmppdvaamglwalfdgllqgw
mlshggfdllevsrvtvdaylrglgfelgvd
Download sequence
Identical sequences gi|301631137|gb|XP_002944663|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]