SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|50418098|gb|AAH77679| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|50418098|gb|AAH77679|
Domain Number - Region: 16-75
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0811
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|50418098|gb|AAH77679|
Sequence length 79
Comment MGC89859 protein [Xenopus (Silurana) tropicalis]
Sequence
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA
SLFMGFGVLFLLLWVGIYV
Download sequence
Identical sequences A0A1L8GJC5 D3ZS52 Q6DDB3 Q6GP81
gi|148231666|ref|NP_001085730| gi|49119237|gb|AAH73260| gi|82184385|sp|Q6GP81| ENSRNOP00000051028 ENSRNOP00000051028 gi|50418098|gb|AAH77679| gi|52346184|ref|NP_001005138| gi|82182402|sp|Q6DDB3| ENSXETP00000057416 NP_001005138.1.99540 NP_001085730.1.7800 XP_001066513.3.100692 XP_002727271.2.4139 XP_015248165.1.42780 10116.ENSRNOP00000051028 ENSXETP00000057416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]