SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58476345|gb|AAH89678| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58476345|gb|AAH89678|
Domain Number 1 Region: 40-272
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.01e-53
Family PP-loop ATPase 0.021
Further Details:      
 
Weak hits

Sequence:  gi|58476345|gb|AAH89678|
Domain Number - Region: 280-298
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0824
Family Recombination protein RecR 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|58476345|gb|AAH89678|
Sequence length 341
Comment MGC107918 protein [Xenopus (Silurana) tropicalis]
Sequence
MPVNCSSCEERRAVLRRPKTGHSLCKDCFFHAFEEEIHHTIVSAKLFNPGEKVGIGASGG
KDSTVLAHVLKVLNERYAYGLDLILVSVDEGISGYRDDSLETVKRNQQQYELPLKIVSYQ
ELYGWTMDQIVKQVGLKNNCTFCGVFRRQALDRGAMMLGVNKICTGHNADDIAETVLMNF
LRGDIARLRRCTSITTGSEGAIPRCKPLKYAYEKEIVLYAYFKKLDYFSTECIYSPNAYR
GHARAFLKDLEAIRPSSIMDIIHSGENLSVKEDVRMPVQGTCTRCGYISSQSLCKACVLL
EGLNRGLPKLGIGKHHKLHHKLLSQEPLSEQEERKLKAVDF
Download sequence
Identical sequences Q5FW05
8364.ENSXETP00000008736 ENSXETP00000008736 ENSXETP00000008736 gi|58476345|gb|AAH89678| gi|62751601|ref|NP_001015743| gi|82179029|sp|Q5FW05| NP_001015743.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]