SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62858183|ref|NP_001016482| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62858183|ref|NP_001016482|
Domain Number 1 Region: 259-516
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 3.66e-109
Family Transcriptional factor tubby, C-terminal domain 0.00000000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62858183|ref|NP_001016482|
Sequence length 516
Comment tubby like protein 1 [Xenopus (Silurana) tropicalis]
Sequence
MASSKKIKKKSEGQEPITQTEKVSKKSKGKKGEDLDSEDQNQATKKLKKKKSEATQDKEG
AQKSKEATSKSKEATSKSKDTAKETSKGKKNIGLSRFNASKTSKQRLGSEGESEEEEAPK
KPKKKGSSESTSESKETKQKGDENKSEKKNAKAKDKKRESGSMFQINGGKKEEKNIKKGQ
GNADKDSDSNSKPLKSTKKRATSMFQTKGDVSKDVKGKKKGLAKSNEEEEEEEELTKNTN
KKGKRGKKSKKKEERPVSPVIEVDNLEEFVLRPAPQGVTIKCKVTRDKKGMDRGLYPTYY
VHLDNDKKVFLLAGRKRKKSKTSNYLISIDATDLSRGGENFIGKLRSNLMGTKFTVFDNG
ASPDKANSDWSNVRQELAAIVYETNVLGFKGPRKMTVLIPGMDEDCERVPVRPRNDNDGL
LQRWQNKNMENLIQLHNKSPVWNDETQSYVLNFHGRVTHPSVKNFQIVHADDLDYIIMQF
GRVADDAFTMDYKYPMCAVQAFAIALSSFDGKLACE
Download sequence
Identical sequences Q28HH4
gi|62858183|ref|NP_001016482| gi|89272897|gb|CAJ83191| NP_001016482.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]