SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116487489|gb|AAI25779| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116487489|gb|AAI25779|
Domain Number 1 Region: 523-554,638-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116487489|gb|AAI25779|
Sequence length 767
Comment slc26a4 protein [Xenopus (Silurana) tropicalis]
Sequence
GYNQYLVHRSVYNEPTFQDDNERKERVQKTVQDRIKKNCSCTSKKAYFIVKKFFPVLDWL
PKYRWKEWFVNDLISGVSTGLVGTLQGLAFALLAAVPVGYGLYSSFFPILTYFFLGTSKH
ISVGPFPVVSLMVGSVVLSIAPDEKFAILGNATGLNKTIIDTVARDAARIAVSGTLSFLI
GIIQLALGIFQIGFIVRYLADPLVGGFTTAAAFQVFVSQFKLVLNVPTQNYNGVLSIIYT
IRDIFMNIRLTNIADLIAGLLTFVVCVVVKEINDRYKRIFRVPIPIEVIVTIVATGISYG
VNLHAKYNAGIVATIPSGFIPPMTPDVSLFSQIGSSAFSIGIVAYAVAVSVGKVYATKHN
YEVDGNQEFIAFGISNLFGGAFSCFCATTALSRTAVQESTGGRTQIAGIISAGIVLIAIV
ALGRLLEPLQKSVLAAIVIANLKGMFWQVFDIPRLWKQNKWDSAIWVFTCIASIFLGLDS
GLLAGLLFGLATILLRVQFPSCGALGNVPGTDIYKNVKEYKNLIEPEGVKIIRHTSGMFY
GNIDGFKNAIKSIVGFDPVKVYNKRTKALRKIQKLIKKGQLRSTKNGVISNTGTDNEGFE
PDEDVEDPEQENNGAVQTKEVEIQVDWNSELPVKISVPKVSIHSIIFDFGQIHFIDVVAV
RSLKVIFKELKRIDVEPYIAACEDGVLQKMGSCLFFDEIIKHDIFFLTVHDAVLHIENLR
KFYDGHDPLLEKISLMQESKEPLEFTTIDPTDQELDAQEGALRSLAH
Download sequence
Identical sequences A0JM84
gi|116487489|gb|AAI25779|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]