SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301607111|gb|XP_002933158| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301607111|gb|XP_002933158|
Domain Number 1 Region: 526-557,641-715
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000033
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301607111|gb|XP_002933158|
Sequence length 790
Comment PREDICTED: pendrin-like [Xenopus (Silurana) tropicalis]
Sequence
mssgnnqylvrrsvyteqnfqeenekreivkksfqtrikgncsctsrkallfiksvlpia
dwlpqyrwkewiigdfvagvtvglistlqglafallaavpagyglyssffpvltymflgt
skhlsvgpfpvvslmsgivvqsmapdemfiissnstgtnntvintaardaarveitgslc
fligiiqlllgvfqigfivrflgspivggftwaaafqvlvtqvkqwlnvpaknyigvfsi
iytirdifsnigktniadliagilafivcavvkevnerykhilripipieiivtivatgi
syganlekvynagiikniprgflppmtpkvsiftdligsafsigivayavavsvgkvyga
khsypiignqefiafgvsnmfggafscfcastalsrtaiqesiggktqiasavsagilli
ailalgklleplqksvlsaivivnlkgmfwlikdvprlwkesrwdsvswvvsciaaiilg
ldigllvgllfglltvmirvqfpscsslgnvqgtdiyknvkiykhisepagmkivrfssa
ifygnveglkngiksivgfdavrvfnkrnkalrkikklikkgeisslqngtinntgtdne
aferdddpedqekvdspevqtkeveiqvdwnselpvkvsvpkvsihsiifdfgqilflds
vamkslksiinefrridvlpyiaacddnvlaqmergnffddtikpeicfmtvhdavlyiq
skfsdghdpllekisllqeakestdvteddqgyeeldtqdqdmsvlshivlfdfltfnpg
vtwgiadrni
Download sequence
Identical sequences gi|301607111|gb|XP_002933158|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]