SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301624799|gb|XP_002941689| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301624799|gb|XP_002941689|
Domain Number 1 Region: 22-281
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-56
Family YWTD domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 633-888
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-54
Family YWTD domain 0.00000478
Further Details:      
 
Domain Number 3 Region: 332-562
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-50
Family YWTD domain 0.00000192
Further Details:      
 
Domain Number 4 Region: 935-1194
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-38
Family YWTD domain 0.0000643
Further Details:      
 
Domain Number 5 Region: 1325-1360
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 1246-1286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 7 Region: 1287-1323
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 8 Region: 589-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000351
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 9 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000073
Family EGF-type module 0.023
Further Details:      
 
Domain Number 10 Region: 286-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000766
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1204-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  gi|301624799|gb|XP_002941689|
Domain Number - Region: 1435-1477
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0462
Family Prokaryotic proteases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|301624799|gb|XP_002941689|
Sequence length 1603
Comment PREDICTED: low-density lipoprotein receptor-related protein 5-like [Xenopus (Silurana) tropicalis]
Sequence
mgilpgvsllfcyclasswgsplllfanrrdvrlvdaggtklesvvvvsgledaaavdfl
ysqgviywtdvseesikqtlynqssnlqtvvisglvspdglacdwigkklywtdsetnri
evgnlngtyrkvlfwqdldqpraialdpahgymywtdwgdtprieragmdgsmrkvivdt
diywpngltidldeqklywadaklsfihranldgsfrqkvvegslthpfaltlagdtlyw
tdwqtrsihacnkrtgekrreilsslyspmdiqvfskerqpyfptpcdesnggcshlcll
sprepfysctcptgvqltqdgktcktgaddvlllarrtdlrrisldmpdftdivlqiddi
rhaiaidydpvegyiywtddevkairrayldgsgaqtlvttevqhpdgiavdwvarnlyw
tdtgtdrievtrlngtsrkilisenldepraivlhpltgymywtdwgenpkiesayldgs
ermvlvnsslgwpnglaldlqdgklywgdaktdkievinvdgsnrktlledklphifgft
llgdyiywtdwqrrsiervhkvrasreiiidqlpdlmglkaasvsntfgtnpcadnnggc
shlcffsprgvrcscpiglellsdmrtciipeaflvftsratihrisletnnndvaiplt
gvkeasaldfdvsdnrlywtditlktisrafmngssvehviefgldypegmavdwmgknl
ywsdtgtnrievsrldglyrqvlvwkdldnprslaldpakgymywtewggkprivraymd
gtnsiilvdkvgrandltidyadqrlywtdldtnmiessnmlgaerviiaddlphpfglt
qysdyiywtdwnlhsieradklngnnrtliqdhldfvmdilvfhssrqdglndcmqnngh
csqlclavpkgykcscsshytldsnnrncsppsnfllfsqktainrmlldeqqspditlp
ihglrnvkavsydpldkliywvdgrqniikrakddgtqpfvvvstpnqsqtpekqphdls
idiyshtlywtcegtntinanklngesigvvlrgdhdkpraiavnaergylyftnmqers
pkieraafdgterevlfstglirpvalvvdnklgklfwvdadlkriessdlsganrvtle
dsnilqpmgltilgdhlywidkqqqmiervektngirrtkiqgriahptgihavesvdmn
efsahpcsrnnggcshicitkgdgtprcscpvhlvllqnlltcgepptcspeqftcatgd
idcipmawrcdgfsecddnsdeencpvcssnqfqcekgqcidarqkcngeidcqdksdel
dcdsiclpdqfrcangqcimmsqqcdtfpdcsdssdelicdkppsektpshssaigpvig
iilsvfvmgglyfvcqrvvchrytgpngpfpheyisgtphvplnfittrssqpntytgis
ygkpmigsmsimggssgaplydrnhvtgassssssstkatlypqilnpppspatdrslyn
tevfyssnspsttrsyrpylirgiappttpcstdvcdsdyttsrwkankyymdlnsdsdp
ypppptprsqymsaeescppspttersyfhlyppppspctdss
Download sequence
Identical sequences gi|301624799|gb|XP_002941689| XP_002941689.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]