SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|301629467|gb|XP_002943861| from Xenopus (Silurana) tropicalis v7.1 (annotation v7.2)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301629467|gb|XP_002943861|
Domain Number 1 Region: 9-299
Classification Level Classification E-value
Superfamily Heme iron utilization protein-like 6.18e-80
Family HemS/ChuS-like 0.000011
Further Details:      
 
Domain Number 2 Region: 419-750
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 4.84e-77
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.00000147
Further Details:      
 
Domain Number 3 Region: 296-409
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 0.000000000000051
Family TM0189-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|301629467|gb|XP_002943861|
Sequence length 756
Comment PREDICTED: hypothetical protein LOC100489445 [Xenopus (Silurana) tropicalis]
Sequence
mnapdirarfaqaraagkrhkdaaesigvsegaalaahvgahgaplravplrapwlellq
alqpcgpllaltrnaatvhektgiyeklsatgpvglalgdaidlrlffhhwhagfavtea
aahpdtpaalslqffdahglavhkvfcreaanraafeavmqrfidptlaplfqaqppapa
pqpdsaidapgllaawaamqdtheffdllkrfgaerqqsfrfaegrftrraaktaprqll
qqaardgapimvfvgspgciqihtgpvvrieplemqgaqwlnvldpgfnlhlcedaieqa
prvlfvlshgpsaqvggqgtagdalirlaggvnaltgftgyrpmtaealassapdfilat
eqgiealggpqkfwqrpeltltpayqrralialdalllmgfgprlpqaqpgtgrllaphs
alalglalvvlafitgstngaypiapaqllgalahvvsgtapdtpqqlvflnirlprlll
gaaagaglalagalmqglfrnpladpglvgissgaalaagltivlgpiwfpalphalgsw
tlmltafagglavtgfiyrfaqgpsgthvglmllagvainalagaglgylnfmatdeqlr
niqfwllgslggarwsavalvttvvalccaaalawarplnaialgeaqaallgvhvertk
raavfltalavgaitattgiisfvgliaphwvrlltgpdhrvvlpcsallgaalvlaada
vartvvqpaelplgvltaaiggpmflwmlrhfrgri
Download sequence
Identical sequences gi|301629467|gb|XP_002943861|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]