SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387875150|ref|YP_006305454.1| from Mycobacterium sp. MOTT36Y

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387875150|ref|YP_006305454.1|
Domain Number 1 Region: 305-459,497-552,582-674
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.13e-38
Family Tandem AAA-ATPase domain 0.00042
Further Details:      
 
Domain Number 2 Region: 6-235
Classification Level Classification E-value
Superfamily Caspase-like 0.00000000000000732
Family Caspase catalytic domain 0.032
Further Details:      
 
Domain Number 3 Region: 864-1005
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000000235
Family Achaeal helicase C-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387875150|ref|YP_006305454.1|
Sequence length 1031
Comment DEAD/DEAH box helicase [Mycobacterium sp. MOTT36Y]
Sequence
MKFHGLFIGIDRYADLNIQWLSGAVRDARAIHALFADTIPDSSHVLLTDGDATASGIRAA
LAALAAQSGPDDVVFIFYAGHGSETHEIVCFDTDVRDLAGTSLPLDELADTLSGIEGTTI
LCALDCCFSGGLGSRVFATGARARGLTRSTASDILSRFVGTGRLVLTASADDEEAFESAV
HGHGLFTYRLLEALQGVDEVRQGDQIDLLKVVSYVNQRVLADSAQMLEVQTPTLRGQLDG
TLLWPTFIPGPQYGALFPDRVRQPATADPTSLAAFGVPQDVLDIWAANIDQLNELQLRAV
NDFGVLDGNNLVVTAPTSSGKTMVGELAAIKAAASRGRTVFLLPMKALVNDKYEQFTRIY
GPAGIKTIRATGDYSDQMSEFLRGQYDFALLTYEKLTHLALANPHVLDSISVVVVDEAQT
LTDRTRGSNLEFLMTLLNNRRGRVGSPQVITLSAVVGDLGGLDRWIGGGHLHSTARPVPP
REGVVGQSGALQIVNEDGTEATIPAFIRPIPHEGSCSLVIPLVRKLVGEGKTVIVFRETK
GEVAGCAVYLSDALGLPAADGVLEAMNTGEVSSSTETLRRTLARGVAMHTADLDRTERHA
IESAFRDPDSSLNVIVGTTTLAMGVNTPASAVVIVGLTHPGPRPTPYSVAEYKNMVGRAG
RLGFSELGESYLIPNDTLGTGNAWHNYVHGELEPLRSQLVADGDPRTLMLRVVAQFQGES
GHAVSEEAVIGFLDSSLAAQQAREGGNRQWTTEQLGYGFDQLVAARLLEAETDGYRLTAL
GRFTGESGVHVDSVVRLSSALAGLDATALNSTTLIAAAQLTVEVDAVYIPVSGRKNNPEP
TVWVSTLSQQQVARPTLRVLQNTAPDIATMTRRAKKASAAIMLINGIDIAVLERNLNQHV
WGRPAMAGAVRSAADRTRDLLPAVGAVLVELYPEHVDAIQSLVGRTLTRLEFGVPPELID
LARLDAGLSRQQLLALLNAGYANPQSVAEADIAALAEAMGSKEGADVLVEACRTAIGQPA
PSGIELPTPSE
Download sequence
Identical sequences I2ABQ3
gi|387875150|ref|YP_006305454.1| WP_014711310.1.101477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]