SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|375138945|ref|YP_004999594.1| from Mycobacterium rhodesiae NBB3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|375138945|ref|YP_004999594.1|
Domain Number 1 Region: 44-351
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 7.98e-70
Family Heme-dependent catalases 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|375138945|ref|YP_004999594.1|
Sequence length 365
Comment catalase [Mycobacterium rhodesiae NBB3]
Sequence
MKPSGFGGAEEGEGRFKVDRRSLLTGLAAVGAFLVVDLGAVAYANNWIRPAGAFTRQTII
DALRATYGVHPGFRKNHAKGVAVTGFFDSNGNGAALSSAEVFTRRRTPVLGRFSLAGGDP
AIEDSLTAARGLGLAFGLTGAQQWRTAMLNLPVFPDNSAHGFYERILASKVVPGTGKPDP
AAMERFLAAHPETAAAMAVIKAHPPTPGFADSTFSGLNTFLFTDRAKRVTPVRWSLVPEQ
AALPARPGRDGLFDALVRQLRSTPLRWRMEIVVGESADPIDDATLPWPAERRRVDVGTVT
LTGAQTEAPGNARDVNFDPLVLPTGIAPSADPLLSARSSTYAASYHLRTGEPTTPSAVQV
DEVVQ
Download sequence
Identical sequences G8RLB7
gi|375138945|ref|YP_004999594.1| WP_014210193.1.79459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]